| integrative taxonomy helps to reveal the mask of the genus gynandropaa (amphibia: anura: dicroglossidae). | species of the genus gynandropaa within the family dicroglossidae are typical spiny frogs whose taxonomic status has long been in doubt. we used integrative methods, involving morphological and molecular analyses, to elucidate the phylogenetic relationships, and to determine identities and the geographic distribution of each valid species. we obtained dna sequence data of 5 species of gynandropaa (complete sequences of the mitochondrial nadh dehydrogenase subunit 2 [nd2] gene, and 890 bp of 12s ... | 2016 | 26531851 |
| structure and function of a potent lipopolysaccharide-binding antimicrobial and anti-inflammatory peptide. | antimicrobial peptides (amps) play pivotal roles in the innate defense of vertebrates. a novel amp (cathelicidin-py) has been identified from the skin secretions of the frog paa yunnanensis . cathelicidin-py has an amino acid sequence of rkcnflcklkeklrtvitshidkvlrpqg. nuclear magnetic resonance (nmr) spectroscopy analysis revealed that cathelicidin-py adopts a tertiary structure with a mostly positively charged surface containing a helix (thr15-ser19). it possesses strong antimicrobial activity, ... | 2013 | 23594231 |
| genealogy and palaeodrainage basins in yunnan province: phylogeography of the yunnan spiny frog, nanorana yunnanensis (dicroglossidae). | historical drainage patterns adjacent to the qinghai-tibetan plateau differed markedly from those of today. we examined the relationship between drainage history and geographic patterns of genetic variation in the yunnan spiny frog, nanorana yunnanensis, using approximately 981 base pairs of mitochondrial dna partial sequences from protein-coding genes nd1 and nd2, and intervening areas including complete trna(ile), trna(gln) and trna(met). two null hypotheses were tested: (i) that genetic patte ... | 2010 | 20666999 |
| shared response to changes in drainage basin: phylogeography of the yunnan small narrow-mouthed frog, glyphoglossus yunnanensis (anura: microhylidae). | with the late cenozoic uplift of the qinghai-tibetan plateau (qtp), drainage of the southeastern edge of the qtp changed significantly. however, the impact of this dramatic change on the geographical distribution and genetic diversity of endemic organisms is still poorly understood. here, we examined the geographical patterns of genetic variation in the yunnan small narrow-mouthed frog, glyphoglossus yunnanensis (microhylidae), and two alternative hypotheses were tested: that is, the geographica ... | 2020 | 32076534 |