| azo- and nitro-reductases of the cestode moniezia expansa. substrate specificity, reaction products and the effects of flavins and other compounds. | 1. the effects of various inhibitors and activators on the azo- and nitro-reductases of moniezia expansa have been studied. both reductions were partially inhibited by fad, fmn, riboflavin, allopurinol, dicoumarol, 5-nitro-2-furaldehyde, azide and cyanide at 1 mm. both reactions were stimulated by hypoxanthine. menadione, nitrofurantoin, skf 525-a (2-diethylaminoethyl 2,2-diphenylvalerate) and fluoride were without effect. 2. xanthine- and aldehyde-oxidase activities were not detected in the enz ... | 1976 | 11614 |
| the metabolism of niclosamide and related compounds by moniezia expansa, ascaris lumbricoides var suum, and mouse- and sheep-liver enzymes. | 1. niclosamide and related nitro compounds were reduced to the corresponding amines by moniezia expansa, ascaris lumbricoides var suum and by enzymes prepared from these species and by mouse and sheep liver homogenates. the reduction of niclosamide by the helminths required as cofactors nadh2 and glutathione, but was inhibited 50% by 2 x 10(-7) m allopurinol. 2. unlike benzanilide, niclosamide was not hydrolysed by either the helminths, or the mammalian liver preparations. rates of hydrolysis of ... | 1977 | 19884 |
| studies of regulatory metabolism in moniezia expansa: general considerations. | | 1975 | 123229 |
| parasites of domestic and wild animals in south africa. iv. helminths in sheep on irrigated pasture on the transvall highveld. | the seasonal incidence of helminth infestation in sheep on newly established irrigated pastures was determined by the slaughter of pairs of tracer lambs exposed for periods of approximately 33 days from october 1968--july 1970 and of sets of 3 lambs from march 1971--may 1973. it took several months for the infestation to become established on the pasture, but thereafter, of the various species present; haemonchus contortus was most prevalent. in general, peak burdens of this species were recover ... | 1977 | 148623 |
| efficacy of oxfendazole against natural infestations of nematodes and cestodes in sheep in egypt. | oxfendazole liquid suspension (systamex; wellcome) was administered orally at the dose of 4.5 mg per kg to 800 indigenous egyptian sheep clinically affected with dictyocaulus filaria, moniezia expansa, haemonchus contortus, ostertagia circumcincta, nematodirus spp, trichostrongylus axei, cooperia curticei, trichuris ovis and oesophagostomum spp. a 100 per cent clearance was recorded for all parasites with the exception of t ovis which were markedly reduced in number. | 1979 | 157586 |
| in vitro hatching of the tapeworm moniezia expansa (cestoda: anoplocephalidae) and some properties of the egg membranes. | in vitro studies revealed that the hatching of oncospheres of moniezia expansa requires the mechanical breakage of the eggshell and subshell membrane and enzymic digestion of the pyriform apparatus. removal of the outer two egg membranes elicits the activation of most oncospheres. between ph 5.0-7.8, there is no significant difference in numbers of oncospheres activated by eggshell removal and the addition of sodium bicarbonate has no effect. solutions of more extreme ph values (2.0 and 10.0) ar ... | 1975 | 234660 |
| studies of regulatory metabolism in moniezia expansa: the role of phosphofructokinase (with a note on pyruvate kinase). | | 1975 | 236262 |
| studies of regulatory metabolism in moniezia expansa: the role of phosphoenolpyruvate carboxykinase. | | 1975 | 236263 |
| the metabolism of foreign compounds in the cestode, moniezia expansa, and the nematode, ascaris lumbricoides var suum. | 1. the ability of the cestode moniezia expansa and the nematode ascaris lumbricoides var suum to metabolize foreign compounds has been assessed. 2. both species were unable to oxidase aldrin, aniline, biphenyl, butylbenzene and nitrobenzene or to demethylate aminopyrine, and 4-nitroanisole. 3. m. expansa and a. lumbricoides var suum readily induced 4-nitroanisole, nitrobenzene, 4-nitrobenzoic acid and 4-nitrophenol to the corresponding amines. azobenzene, dimethylaminoazobenzene, and 1,2-dimethy ... | 1975 | 239489 |
| the metabolism of the anthelmintics clioxanide and resorantel and related compounds in vitro by moniezia expansa, ascaris suum and mouse- and sheep-liver enzymes. | 1. clioxanide and related compounds were deacetylated by the cestode moniezia expansa, the nematode ascaris suum, by enzymes prepared from these species and by mouse- and sheep-liver homogenates. deacetylase activity was found in the cytosol of cestode proglottids throughout the strobila, and in the cytosol of nematode intestinal cells and reproductive tract. 2. the o-deacetylases from both helminths showed similar ph optima of about 7.0. activity was enhanced by ca2+ and low molecular weight th ... | 1979 | 483862 |
| the metabolism of nitrophenolic and 5-arylazorhodanine anthelmintics by ascaris suum, moniezia expansa and by mouse- and sheep-liver enzymes. | 1. the anthelmintics disophenol (2,6-diiodo-4-nitrophenol), nitroxynil (3-iodo-4-hydroxy-5-nitrobenzonitrile) and nitrodan (3-methyl-5-(4-nitrophenylazo)rhodanine) were reduced in vitro to the corresponding amines by intact ascaris suum, moniezia expansa, by enzymes prepared from these helminths, and by mouse- and sheep-liver homogenates. helminth reductases required nadh2 and glutathione as cofactors and were inhibited about 50% by 2.0 x 10(-7) m allopurinol. azo bonds of nitrodan and its analo ... | 1979 | 516789 |
| some properties of the sulphoxidases and sulphoxide reductases of the cestode moniezia expansa, the nematode ascaris suum and mouse liver. | 1. the anthelmintics bithionol, phenothiazine, albendazole and fenbendazole were oxidized to sulphoxides by enzymes in the cytosol of the proglottids of the cestode moniezia expansa and the cytosol of the intestinal epithelial cells of the nematode ascaris suum. enzymes in these tissues were also able to reduce these sulphoxides to the thioethers in the absence of oxygen. 2. sulphoxidation and sulphoxide reduction also occurred in mouse liver enzyme preparations. about 20% of the sulphoxidation ... | 1979 | 532217 |
| the influence of temperature on the development of moniezia expansa (rudolphi, 1810) in oribatid mites. | the life cycle of moniezia expansa was studied experimentally using 10 species of oribatid mites as intermediate hosts. four of them became infected, namely scheloribates laevigatus (76.2%), sch. latipes (70.8%), liacarus coracinus (20%) and platynothrus peltifer (1.1%). the last was found for the first time to serve as intermediate host of m. expansa in czechoslovakia. the development of the cysticercoid of m. expansa in the oribatid mites at 28 degrees c and 85% relative humidity is completed ... | 1979 | 540874 |
| the anthelmintic efficacy of fenbendazole in the control of moniezia expansa and trichuris ovis in sheep. | the anthelmintic efficacy of fenbendazole (methyl 5-(phenyl-thio)-2-benzimidazole-carbamate) against moniezia expansa and trichuris ovis was tested. at dose rates of 5 mg per kg and above, efficacies were found to be greater than 91 percent against m expansa and greater than 92 per cent against t ovis. at these dose rates efficacy on egg suppression was 100 per cent for moniezia and greater than 97 per cent for trichuris. | 1977 | 605306 |
| moniezia expansa infection in lambs. | | 1978 | 636208 |
| glutathione conjugation of some xenobiotics by ascaris suum and moniezia expansa. | 1. the cestode moniezia expansa and the nematode ascaris suum both possess enzymes catalysing the conjugation of glutathione (gsh) with 1-chloro-2,4-dinitrobenzene. 2. the gsh-s-aryl transferase (gsh-s-transferase a) was present in the cytosol of the cestode proglottids and of the nematode intestinal epithelial cells. other tissues did not contain measurable activity. the enzymes from both species had mol. wt. of about 37 000 and broad ph optima around ph 8.3. both enzymes were inhibited by cu2+ ... | 1978 | 654311 |
| the localization and some properties of the acetylsalicylic acid o-deacetylases of ascaris lumbricoides var suum and moniezia expansa. | 1. enzymes hydrolysing acetylsalicylic acid were found in the cytosol of the cestode, moniezia expansa, and in the cytosol of the intestinal epithelial cells and cytosol of the reproductive tract of the nematode, ascaris lumbricoides var suum. 2. enzymes hydrolysing 2-naphthyl acetate and 4-methylumbelliferyl acetate were found throughout the proglottid of the cestode and in the reproductive tract, intestine, mesenchyme fluid and cuticle of the nematode. these enzymes had mol. wt. of 30 000-300 ... | 1978 | 654312 |
| parasites of domestic and wild animals in south africa. v. helminths in sheep on dryland pasture on the transvaal highveld. | the seasonal incidence of helminth infestation on a farm in the transvaal highveld was determined by the slaughter of tracer lambs exposed on pasture for periods of approximately 6 weeks. haemonchus contortus, the most prevalent nematode, was recovered in the greatest numbers from january--may 1974. peak counts of ostertagia circumcincta were made during march and april 1974 and in january 1975, while trichostrongylus spp. were mainly encountered from march--june. cooperia spp. were generally re ... | 1978 | 704040 |
| molecular structure and morphology of glycogen isolated from the cestode, moniezia expansa. | a particulate polysaccharide was isolated by differential centrifugation and alkali extraction from homogenates of the cestode moniezia expansa. the polysaccharide had the structure of a glycogen. its chemical properties, infra-red spectrum and optical rotation showed that it consisted of alpha-1,4- and alpha-1,6-linked glucopyranose units. examination of the complex with iodine and the precipitate with concanavalin-a showed that the structure was highly branched. oxidation with periodate and hy ... | 1976 | 967531 |
| azo-and nitro-reductase activities and cytochromes of axcaris lumbricoides var suum and moniezia expansa. | 1. isoelectric focusing failed to separate the azo- and nitro-reductases in enzyme preparations from either the nematode ascaris lumbricoides var suum or the cestode moniezia expansa. the isoelectric point of the reductases from a. lumbricoides var suum was 4-75, and that of the reductases from m. expansa, 4-50. 2. cytochromes p-450 and b5 were not detected in the 100 000 g pellet of tissue homogenates from either a. lumbricoides var suum of m. expansa. these cytochromes were not induced in eith ... | 1976 | 983123 |
| laboratory infections of scheloribates spp. (oribatid mites) with moniezia expansa and m. benedeni. | scheloribates laevigatus (koch, 1836) and scheloribates fimbriatus (thor, 1930), predominant species of oribatids in soil of bombay region, were experimentally exposed to infection by uniform suspensions of eggs of moniezia expansa and m. benedeni. the percentages of mites infected and the average number of cysticercoids developing were observed in 12 sets of experiments. the mites were more readily infected with eggs of m. expansa than with those of m. benedeni. s. laevigatus were infected with ... | 1976 | 993572 |
| subcellular localization and some properties of the n-deacetylase of the cestode moniezia expansa. | 1. acetanilide, acetamidophenol, acetanisidide, acetamidobenzoic acid and acetamidobenzaldehyde were hydrolysed by enzyme preparations from moniezia expansa. deacetylation occurred in the distal cytoplasm of the proglottids. 2. n-deacetylase activity was found in the 75 000g supernatant of the tapeworm homogenates. the molecular weight of the enzyme was about 95 000. 3. the optimal ph of deacetylation for all substrates was 7-4. dithiothreitol enhanced the reaction, but glutathione and cysteine ... | 1976 | 1007321 |
| studies of regulatory metabolism in moniezia expansa: glutamate, and the absence of the gamma-aminobutyrate pathway. | | 1975 | 1126788 |
| ultrastructural studies of the cysticercoid of moniezia expansa (anoplocephalidae) with special reference to the development of the cyst. | cysticercoids of the sheep tapeworm moniezia expansa have been grown in oribatid mites in the laboratory. three species of mite became infected: xenillus tegeocranus, platynothrus peltifer and euzetes globulus, the latter not previously recorded as a host of anoplocephalines. cysticercoids aged 15 and 28 weeks were examined with the electron microscope. four distinct types of cells were found in the 15-week cysticercoid. subsequent cyst development involves a transformation from a cellular to a ... | 1976 | 1258526 |
| efficacy of p-toluoyl chloride phenylhydrazone against gastrointestinal helminths in ovines. | a new anthelmintic candidate, p-toluoyl chloride phenlylhydrazone, was administered to lambs in a paste formulation. the efficacy of this drug was determined at dose rates of 20, 30, 40, and 50 mg of active ingredient per kilogram of body weight. helminths expelled by these dosages included haemonchus contortus, ostertagia circumcicta, trichostrongylus colubriformis, t. axei, nematodirus filicollis, cooperia curticei, strongyloides papillosus, oesophagostomum columbianum, bunostomum trigoncephal ... | 1976 | 1263040 |
| neuropeptide f: primary structure from the tubellarian, artioposthia triangulata. | 1. a neuropeptide exhibiting vertebrate pancreatic polypeptide immunoreactivity has been isolated and sequenced from extracts of the terrestrial turbellarian, artioposthia triangulata. 2. this neuropeptide, designated neuropeptide f, consists of 36 amino acid residues terminating in a phenylalaninamide. 3. the full primary structure was established as: kvvhlrprssfssedeyqiylrnvskyiqlygrprf.nh2. the molecular mass, deduced from this sequence, was 4433 da. 4. this neuropeptide exhibits c-terminal h ... | 1992 | 1354101 |
| parasites of south african wildlife. xiii. helminths of grey rhebuck, pelea capreolus, and of bontebok, damaliscus dorcas dorcas, in the bontebok national park. | a total of 25 grey rhebuck, pelea capreolus, and 16 bontebok, damaliscus dorcas dorcas, were shot for parasite recovery at bi-monthly intervals in the bontebok national park, south-western cape province, from february 1983 to december 1983 and february 1983 to february 1984, respectively. the grey rhebuck and the bontebok each harboured 9 nematode species and the latter animals 1 cestode species. ostertagia hamata was most abundant and most prevalent in the grey rhebuck and longistrongylus curvi ... | 1992 | 1437019 |
| neuropeptide f (moniezia expansa): localization and characterization using specific antisera. | immunocytochemical techniques used in conjunction with confocal scanning laser microscopy (cslm) and electron microscopy have been used to demonstrate, for the first time, the distribution of the parasitic platyhelminth neuropeptide, neuropeptide f (npf) in the cestode, moniezia expansa. antisera were raised to intact npf(1-39) and to the c-terminal decapeptide of npf(30-39). these antisera were characterized and validated for use in both immunocytochemistry and radioimmunoassay (ria). npf immun ... | 1992 | 1461689 |
| the primary structure of neuropeptide f (npf) from the garden snail, helix aspersa. | neuropeptide f (npf), originally isolated from the sheep tapeworm, moniezia expansa, consists of 39 amino acid residues terminating in a phenylalaninamide. an analogous neuropeptide has been isolated and sequenced from extracts of circumoesophageal ganglia of the garden snail, helix aspersa. this neuropeptide exhibits partial primary structural similarity to members of the vertebrate neuropeptide y (npy)/pancreatic polypeptide (pp) superfamily. npf is thus of widespread occurrence in the nervous ... | 1992 | 1472263 |
| neuropeptide f-immunoreactivity in the monogenean parasite diclidophora merlangi. | the localisation and distribution of neuropeptide f (npf)-immunoreactivity (ir) in the monogenean fish-gill parasite, diclidophora merlangi, have been investigated by whole-mount immunocytochemistry interfaced with confocal scanning laser microscopy and, at the ultrastructural level, by indirect immunogold labeling. using antisera directed to intact synthetic npf (moniezia expansa, residues 1-39) or to the c-terminal decapeptide (residues 30-39) of synthetic npf (m. expansa), immunostaining was ... | 1992 | 1480601 |
| infectivity of moniezia benedeni and moniezia expansa to oribatid mites from ohio and georgia. | six species of oribatid mites belonging to four families and five genera were successfully infected by m. benedeni. they were scheloribates laevigatus (scheloribatidae), exoribatula sp. cf. biundatus (scheloribatidae), xylobates capucinus (haplozetidae) and zygoribatula undulata (oribatulidae) from ohio, and galumna ithacensis (galumnidae) and scheloribates lanceoliger (scheloribatidae) from georgia. cysticercoids were also recovered from s. laevigatus infected with m. expansa. among the six spe ... | 1992 | 1485410 |
| seasonal variation of oribatid mite (acarina) populations and their relationship to sheep cestodiasis in argentina. | samples of soil were collected monthly from two ranches in the zone of puan, province of buenos aires, argentina. the monthly distribution of males, females without eggs and females with eggs for the dominant species of oribatid mites were studied. the dominant species were zygoribatula lata in ranch a, and zygoribatula elongata in ranch b. both species are hosts of moniezia expansa rudolphi, 1810 and helictometra giardi baer, 1927. based on the data presented, the factors associated with transm ... | 1992 | 1615627 |
| [the effect of temperature and relative humidity on survival of eggs of the cestode, monieza expansa (rudolphi, 1810)]. | the survival of moniezia expansa eggs in the droppings of lambs was investigated at various temperatures in laboratory conditions and on test plots outdoors. the optimum temperature of the livability of m. expansa eggs in laboratory conditions is 5 degrees c; at this temperature 10% of oncospheres survived after 161 days. at the temperatures of 10, 25, 35 degrees c the oncospheres survived 105, 28, 46 days respectively, at -12 degrees c it was 28 days. it was for 21 and 35 days that on the test ... | 1991 | 1771731 |
| parasites of domestic and wild animals in south africa. xxviii. helminth and arthropod parasites of angora goats and kids in valley bushveld. | two adult angora goats were slaughtered each month for 24 consecutive months on a farm in valley bushveld in the eastern cape province. on the same farm 2 angora goat kids were slaughtered each month for 2 consecutive years from the time they were 1 week old until they reached 12 months of age. all these goats were processed for the recovery of helminth and arthropod parasites. fourteen nematode species, 2 nematode genera and 1 cestode species were recovered. worm burdens were generally low in t ... | 1991 | 1780125 |
| periparturient rise in faecal nematode egg counts in west african dwarf sheep in southern ghana in the absence of arrested strongyle larvae. | the nematode egg output of two groups of ewes, a pregnant test group (2-3 years of age) mated between march and april and a non-pregnant control group (5-6 years of age) was followed. the worm burdens acquired by worm-free 'tracer' lambs were also followed on the same pasture from march 1988 to february 1989. there was a significant difference (p less than 0.05) in the magnitude of the egg output in the test group compared with the control group. in the test ewes, an initial rise in egg producti ... | 1991 | 1897121 |
| echinococcus multilocularis: characterization of a dna probe. | a 0.6 kb dna fragment has been isolated from a genomic sublibrary of the cestode echinococcus multilocularis. this dna-fragment showed a strong hybridization signal to 32pdctp labeled total dna prepared from e. multilocularis metacestode material. the fragment was subcloned into the escherichia coli vector bluescript bs+ resulting in the recombinant plasmid pal1. the recombinant parasite dna probe was labeled by biotinylation and hybridized to southern blots of resolved ecori/psti digested genom ... | 1990 | 1980566 |
| a novel nadph/nadh-dependent aldehyde reduction enzyme isolated from the tapeworm moniezia expansa. | an aldehyde reduction enzyme has been purified from the cytosol of the tapeworm, moniezia expansa, by chromatofocusing and reactive-red chromatography. the enzyme is monomeric (subunit 34 kda) and can utilise nadh and nadph as co-factors. substrates of the enzyme include alkanals, alka-2,4-dienals and alk-2-enals, established secondary products of lipid peroxidation. the enzyme reduced methylglyoxal, another possible natural substrate (m. expansa lacks glyoxalase i activity). the parasite enzyme ... | 1990 | 2185955 |
| the epidemiology of helminthosis in small ruminants under the traditional husbandry system in eastern nigeria. | the epidemiology of helminth infections in west african dwarf sheep and goats under the traditional husbandry system prevailing in the derived savanna area of eastern nigeria was studied for 12 months. the infections observed were due to haemonchus contortus (87.1%), trichostrongylus spp. (63.8%), metacestodes of taenia hydatigena (30.2%), oesophagostomum columbianum (22.4%), strongyloides sp. (18.8%), cooperia spp. (17.2%), gaigeria pachyscelis (6.0%), moniezia expansa (6.0%), bunostomum trigon ... | 1990 | 2247944 |
| comparative efficacy of praziquantel, albendazole, febantel and oxfendazole against moniezia expansa. | | 1990 | 2260242 |
| glutathione transferases in the tapeworm moniezia expansa. | four forms of gsh transferase were resolved from moniezia expansa cytosol by gsh-sepharose affinity chromatography and chromatofocusing in the range ph 6-4, and the presence of isoenzymes was further suggested by analytical isoelectric focusing. the four gsh transferase forms in the cestode showed no clear biochemical relationship to any one mammalian gsh transferase family. the n-terminal of the major gsh transferase form showed sequence homology with the mu and alpha family gsh transferases. t ... | 1989 | 2590177 |
| cu-zn-superoxide dismutase activity in moniezia expansa: inhibition by pyrimidine derivatives. | copper-zinc, cyanide-sensitive superoxide dismutase (cu-zn-sod) was detected in homogenates of moniezia expansa. the enzyme was purified by a sequence of multiple differential centrifugations, ammonium sulphate precipitation, ion-exchange and g-75 sephadex column chromatography. the final enzyme preparation had a specific activity of 623.00 +/- 9.97u per mg protein and, after isolation, a single-staining band on acrylamide-sds gels was detected which coincided with enzyme activity. the inhibitor ... | 1989 | 2592142 |
| [fascioliasis in moufflons]. | subacute fascioliasis was diagnosed by pathomorphological and parasitological investigations on 13 dead moufflons (ovis ammon musimon) from a herd of 21 animals (mortality 62%) which had succumbed between january and april 1988. the flock had been kept on meadow in the so-called leipziger auenwald. the main findings like severe hepatitis traumatica fasciolosa, fibrinous and fibrous perihepatitis, chronic interstitial hepatitis (pseudocirrhosis), cholangitis fasciolosa (x 13), wasting (x 8), hear ... | 1989 | 2782670 |
| superoxide dismutase in cestodes. isoenzymatic characterization and studies of inhibition by a series of benzimidazoles and by pyrimidine derivatives of recent synthesis. | the activities of superoxide dismutase (sod) (e.c.1.15.1.1) in extracts of five cestode parasites (moniezia expansa, m. benedeni, avitellina centripunctata. taenia hydatigena and dipylidium caninum) were investigated. the polyacrylamide gel electrophoretic patterns revealed that each of the five species had four isoenzyme bands; they could be differentiated principally by their displacements and, less clearly, by their intensities. determinations were made of the inhibitory activities of four be ... | 1989 | 2783180 |
| new potential intermediate host of moniezia expansa rudolphi, 1810, in argentina. | for the first time in argentina, it has been shown that oribatids from the genus ceratozetes berlese, 1908 (acarina:ceratozetidae) have the potential to act as intermediate hosts of moniezia expansa from sheep. zygoribatula lata hammer, 1961 (acarina:oribatulidae) was confirmed as a potential intermediate host of m. expansa. a comparative study of the potential effectiveness of both oribatid species as intermediate hosts of m. expansa from sheep was performed. | 1989 | 2800305 |
| ascorbic acid levels in the proglottides of four species of cestode parasites of mammals and birds in relation to their sexual maturity. | ascorbic acid levels were found to be closely related to different stages of growth and maturity of avitellina centripunctata, moniezia expansa, and stilesia globipunctata from goats and sheep and of raillietina echinobothrida from fowl. the ascorbic acid level in avian parasites was higher than that in mammalian. the level was highest in immature proglottides and lowest in gravid proglottides. | 1988 | 3397519 |
| inhibition of malate dehydrogenase enzymes by benzimidazole anthelmintics. | determinations were made of the inhibitory activities of four benzimidazole anthelmintics (albendazole, parbendazole, mebendazole and thiabendazole) on purified extracts of cytoplasmic and mitochondrial malate dehydrogenase obtained from ascaris suum, fasciola hepatica and moniezia expansa. the highest percentage inhibitions were exhibited by mebendazole. the results confirm that cytoplasmic mdh and mitochondrial mdh regulator enzymes of glycogen synthesis are the sites of mebendazole inhibitory ... | 1987 | 3617430 |
| chemical nature and mode of stabilization of eggshell/capsule of some cyclophyllidean cestodes. | the chemical nature and mode of stabilization of the eggshell/capsule of moniezia expansa, avitellina lahorea and stilesia globipunctata have been investigated using histochemical techniques. in m. expansa where vitelline glands are present, the eggshell is stabilized by -s-s and -s-h linkages whereas in a. lahorea and s. globipunctata, the vitelline glands are absent and the double membranes, fibrous capsule and paruterine organ contain mainly elastokeratin-type structural protein. the possible ... | 1986 | 3734394 |
| the comparative efficacy of oxfendazole administered as bolus and suspension to naturally infected sheep in greece. | in a flock of 20 ewes naturally infected with those parasites of sheep most common in greece, and kept indoors during the whole trial, oxfendazole at the dose rate of approximately 2.9 and 2.8 mg/kg body-weight was tested as a 4 g bolus containing 112 mg active ingredient and a 2.265% suspension. the evaluation of its efficacy was based on the necropsy findings which were also supported by faecal egg counts. no differences in efficacy were noticed between the two formulations of the drug. both b ... | 1986 | 3745877 |
| [seasonal dynamics of intermediate hosts and survivability of eggs of the sheep tapeworm moniezia expansa (rudolphi, 1810)]. | | 1986 | 3751392 |
| occurrence and biochemical characteristics of cestode lymphocyte mitogens. | the cestodes echinococcus granulosus, taenia multiceps, t. pisiformis, t. hydatigena, hymenolepis diminuta, moniezia expansa and anoplocephala perfoliata all produced substances that stimulated thymidine incorporation by whole blood lymphocyte cultures. this mitogenic activity was demonstrated in metacestode cyst fluids, live protoscoleces and scoleces, parasite culture supernatants, and extracts of adult parasites. t. multiceps metacestode cyst fluid mitogen adhered to, but would not pass throu ... | 1987 | 3822512 |
| the anthelmintic activity of cambendazole in calves and lambs. | tests were carried out on the efficacy of cambendazole (5-isopropoxy carbonylamino-2-(4-thiazolyl) benzimidazole) against lungworm and gastrointestinal parasites of calves and lambs. against dictyocaulus viviparus the compound was highly effective (80%) against mature worms at levels of 35 mg/kg and over and immature "arrested" worms at 60 mg/kg (71% efective). in the calves the compound was very effective (90 to 99%) against adult haemonchus placei, ostertagia spp., trichostrongylus axei and co ... | 1972 | 4259923 |
| the oxidase systems of moniezia expansa (cestoda). | | 1967 | 4294641 |
| the tricarboxylic acid cycle and associated reactions in moniezia expansa (cestoda). | | 1969 | 4310933 |
| histochemical observations on the tegumentary epithelium and interproglottidal glands of moniezia expansa (rud., 1805) (cestoda, cyclophyllidea). | | 1969 | 4315903 |
| metabolic regulation in moniezia expansa (cestoda): the role of pyruvate kinase. | | 1972 | 4661364 |
| axenomycins, new cestocidal antibiotics. | axenomycins are a new group of macrolide antibiotics isolated from the fermentation broth of streptomyces lisandri n.sp. they exhibit anthelmintic activity against tapeworms (cestoda). three different fractions, a, b, and d, have been obtained, the most active fraction being axenomycin d. the activities of the axenomycin complex and axenomycin d against hymenolepis nana in mice, taenia pisiformis, dipylidium caninum, and diphyllobothrium sp. in dogs, and moniezia expansa, m. benedeni, and avitel ... | 1973 | 4790622 |
| antigens of moniezia expansa: fluorescent antibody localization. | | 1967 | 4859793 |
| the effect of infestation by nematodes of the family trichostrongylidae and the tapeworm, moniezia expansa, upon the liveweight gain and wool production of young sheep. | | 1964 | 5277892 |
| [oribatidae as vectors of moniezia expansa (rudolphi, 1810) of sheep in the fort lamy region]. | | 1969 | 5408394 |
| the respiratory components of moniezia expansa (cestoda). | | 1968 | 5650413 |
| l-lysine carboxylyase in ascaris lumbricoides and moniezia expansa. | | 1968 | 5726850 |
| membrane (contact) digestion in the three species of tapeworm hymenolepis diminuta, hymenolepis microstoma and moniezia expansa. | | 1968 | 5740543 |
| observations on the nephridial system of the cestode moniezia expansa (rud., 1805). | | 1969 | 5770078 |
| fluorescent antibody study of the post-cysticercoid development of moniezia expansa. | the strobila of moniezia expansa was separated into developmental areas, and these were compared using immunological techniques. agar double diffusion plates and immunoelectrophoresis showed differing antigenic composition or concentration between the strobilar regions studied. conjugation of the antisera with rhodamine lissamine-200 aided in localization of common antigens on tissue sections of the various developmental stages. what appeared to be unique localizations were observed. | 1981 | 6169541 |
| a novel phosphagen phosphotransferase in the plerocercoids of schistocephalus solidus (cestoda: pseudophyllidea). | neither phosphagens nor phosphagen phosphotransferase activity could be detected in fasciola hepatica, hymenolepis diminuta, moniezia expansa or in the plerocercoids of ligula intestinalis. the plerocercoids of schistocephalus solidus, however, possess an active taurocyamine phosphotransferase, although it too contains no detectable phosphagens. the taurocyamine phosphotransferase of s. solidus has an absolute requirement for a divalent metal ion and atp could not be replaced by itp, gtp, ctp or ... | 1981 | 6259575 |
| [prevalence of oribatid mites on sheep pastures and their role as intermediate host for the sheep tapeworm moniezia expansa]. | | 1984 | 6487259 |
| taeniid infection of dogs in zaria nigeria. | diagnostic work carried out over a sixty month period (1978-1982) showed that out of 4211 faecal and intestinal content samples, 522 (12.40%) carried cestode infection. taeniid infection formed 75.86% (396) of this number. out of ten bovine species posted, one had sterile hydatid cyst of the lung. twenty-eight ovine samples were analysed out of which one had fertile hydatid cyst of the lung, three had cysticercus tenuicollis and one had moniezia expansa. only one of the 21 caprine species posted ... | 1984 | 6534899 |
| the occurrence of ecdysteroids in the cestode, moniezia expansa. | the occurrence of free ecdysteroids in the sheep cestode, moniezia expansa, was demonstrated. significant amounts of conjugated ecdysteroids were not detected. characterization of the free hormones by high-performance liquid chromatography monitoring fractions by radioimmunoassay, and by gas chromatography/mass spectrometry (selected ion monitoring) indicated the presence of ecdysone, 20-hydroxyecdysone and 20,26-dihydroxyecdysone. analysis of the ecdysteroids by radioimmunoassay in segments alo ... | 1984 | 6700637 |
| moniezia expansa: the interproglottidal glands and their secretions. | acetylcholinesterase (ec 3:1:1:7) and alkaline phosphatase (ec 3:1:3:1) were detected in secretions of moniezia expansa maintained in vitro. ultrastructural cytochemical studies demonstrated acetylcholinesterase activity on the surface of the microtriches at the base of the interproglittidal glands and in the gland lumen but not in the distal tegument or the gland cells. alkaline phosphatase activity was demonstrated in the cytoplasm of the gland cells and especially in their protoplasmic connec ... | 1983 | 6841962 |
| ribonucleotide levels in six nematodes, a cestode and a trematode. | the levels of ribonucleotides in the nematodes haemonchus contortus, ostertagia circumcincta, trichostrongylus colubriformis, nippostrongylus brasiliensis, ascaris suum and stephanurus dentatus, the cestode moniezia expansa and the trematode fasciola hepatica were measured by high pressure liquid chromatography. the adenylate charge, atp and total adenine nucleotide levels were in general agreement with those determined enzymatically and with published data. udp and guanine nucleotide levels wer ... | 1983 | 6877282 |
| moniezia infection in the dwarf breeds of small ruminants in southern nigeria. | a survey of moniezia infection was conducted among two groups of sheep and goats, of dwarf breeds, in nigeria: (i) those being reared under a traditional, extensive husbandry system in groups of rural villages situated in two different ecological zones; and (ii) those reared under an intensive system on experimental stations in two ecological zones of nigeria. moniezia expansa was the predominant species encountered in the animals. the incidence of moniezia infection was higher in sheep than in ... | 1983 | 6880006 |
| in vitro estimation of glycogen content in three sheep cestodes. | the glycogen content (fresh weight) was biochemically estimated in immature, mature and gravid proglottids of three cestodes, avitellina centripunctata (rivolta, 1874), stilesia globipunctata (rivolta, 1874) and moniezia expansa (rudolphi, 1910), having different niche in the small intestine of sheep. the glycogen gradient was in the order of mature greater than immature greater than gravid proglottids of each species of cestode. maximum glycogen content was found to be in m. expansa and it was ... | 1982 | 7129237 |
| presence of cholesterol in the neutral lipids of three sheep cestodes. | the adult worms of stilesia globipunctata, avitellina centripunctata and moniezia expansa with immature, mature and gravid proglottids and having almost the same length were collected simultaneously from the sheep intestine. neutral lipid concentration is about 2.2, 1.24 and 18.4% of the dried worm tissue respectively. cholesterol is 87.8, 85.7 and 88.0% of the unsaponifiable material respectively. | 1980 | 7217653 |
| moniezia expansa: subcellular distribution, kinetic properties of acetylcholinesterase and effects of inhibitors and anthelmintics. | | 1981 | 7227488 |
| anthelmintic efficacy of fenbendazole against cestodes in sheep and cattle. | the anthelmintic efficacy of fenbendazole fbz against moniezia expansa was tested in sheep and cattle at a dosage rate of 10 mg fbz per kg body mass. twenty seven out of 30 lambs and 8 out of 12 calves were cured of the infestation. | 1980 | 7452654 |
| a novel lipid-binding protein from the cestode moniezia expansa. | a lipid-binding protein (lbp) has been purified from the cytosol of the cestode moniezia expansa. the native lbp was found to be an oligomer of approx. 250 kda, consisting of 11 kda monomers. the lbp bound saturated and unsaturated fatty acids, but not their coa derivatives, with kd values in the range 0.68-7.8 microm. cholesterol, dihydroergosterol, bilirubin and retinoids were also bound, but alpha-tocopherol, bile acids, alk-2-enals and alka-2,4-dienals were not. evidence suggests that there ... | 1995 | 7575480 |
| gaba in the nervous system of parasitic flatworms. | in an immunocytochemical study, using an antiserum and a monoclonal antibody specific for the amino acid, gamma-aminobutyric acid (gaba), gaba-like immunoreactivity (glir) has been demonstrated for the first time in parasitic flatworms. in moniezia expansa (cestoda), glir was seen in nerve nets which were closely associated with the body wall musculature and in the longitudinal nerve cords. in the liver fluke fasciola hepatica (trematoda), the glir occurred in the longitudinal nerve cords and la ... | 1995 | 7724241 |
| [epidemiology of gastrointestinal helminthiasis in small ruminants in the tree-cropping pasture zone in senegal]. | an epidemiological survey on gastrointestinal helminthiasis in 51 sheep and 51 goats was held in the tree-cropping pasture region in senegal from october 1990 to september 1991. all the animals examined were infected with at least 1 helminth species. three trematodes (fasciola gigantica, schistosoma bovis, amphistomatids), 2 cestodes (moniezia expansa, cysticercus tenuicollis) and 9 nematodes were identified. the most important parasite in sheep was haemonchus contortus while trichostrongylus co ... | 1995 | 7735304 |
| comparative analyses of the neuropeptide f (npf)- and fmrfamide-related peptide (farp)-immunoreactivities in fasciola hepatica and schistosoma spp. | immunochemical techniques were used to determine the distribution, chemical characteristics and relative abundance of immunoreactivity (ir) to two native platyhelminth neuropeptides, neuropeptide f (npf) (moniezia expansa) and the fmrfamide-related peptide (farp), gnffrfamide, in the trematodes, fasciola hepatica and schistosoma mansoni; the larger s. margrebowiei was used in the chemical analysis. extensive immunostaining for the two peptides was demonstrated throughout the nervous systems of b ... | 1995 | 7753578 |
| the purification and properties of glutathione reductase from the cestode moniezia expansa. | glutathione reductase has a central role in glutathione metabolism and as such is a potential target for chemotherapy. the aim of the work was to purify and characterise glutathione reductase from the cestode moniezia expansa and to compare the properties of the helminth enzyme with its mammalian counterpart. the enzyme was purified by a combination of anion exchange and affinity chromatography and further characterized by chromatofocusing and gel electrophoresis. analysis revealed a single isoe ... | 1995 | 7788561 |
| platyhelminth fmrfamide-related peptides (farps) contract schistosoma mansoni (trematoda: digenea) muscle fibres in vitro. | molluscan fmrfamide and two recently discovered platyhelminth fmrfamide-related peptides (farps), gnffrfamide from the cestode moniezia expansa and ryirfamide from the terrestrial turbellarian artioposthia triangulata, cause dose-dependent contractions of individual muscle fibres from schistosoma mansoni in vitro. the most potent farp tested was the turbellarian peptide ryirfamide, which produced a concentration-dependent effect between 10(-9) and 10(-7) m. fmrfamide and gnffrfamide were less po ... | 1994 | 7800413 |
| peptides related to the diploptera punctata allatostatins in nonarthropod invertebrates: an immunocytochemical survey. | the allatostatins are a family of peptides isolated originally from the cockroach, diploptera punctata. related peptides have been identified in periplaneta americana and the blowfly, calliphora vomitoria. these peptides have been shown to be potent inhibitors of juvenile hormone synthesis in these species. a peptide inhibitor of juvenile hormone biosynthesis has also been isolated from the moth, manduca sexta; however, this peptide has no structural homology with the d. punctata-type allatostat ... | 1994 | 7822491 |
| localization of diploptera punctata allatostatin-like immunoreactivity in helminths: an immunocytochemical study. | the nervous systems of helminths are predominantly peptidergic in nature, although it is likely that the full range of regulatory peptides used by these organisms has yet to be elucidated. attempts to identify novel helminth neuropeptides are being made using immunocytochemistry with antisera raised against peptides isolated originally from insects. one of these antisera was raised against allatostatin iii, a peptide isolated originally from the cockroach, diploptera punctata, and a member of a ... | 1995 | 7845717 |
| grillotia erinaceus (cestoda, trypanorhyncha): localization of neuroactive substances in the plerocercoid, using confocal and electron-microscopic immunocytochemistry. | indirect immunocytochemistry, in conjunction with confocal scanning laser microscopy and electron-microscopic immunogold labeling, has been used to localize neuropeptide and 5-hydroxytryptamine (5-ht) immunoreactivities (irs) in the plerocercoid (scolex and surrounding blastocyst) of the trypanorhynch tapeworm, grillotia erinaceus. antisera directed to two native cestode neuropeptides, neuropeptide f and the fmrfamide-related peptide, gnffrfamide, were used to demonstrate the presence of a well- ... | 1994 | 7957760 |
| serotonin and neuropeptide immunoreactivities in the intramolluscan stages of three marine trematode parasites. | using an indirect immunofluorescence technique interfaced with confocal scanning laser microscopy, whole-mount preparations of three genera of marine trematode larvae, cryptocotyle lingua, cercaria emasculans and himasthla leptosoma, were screened for 5-hydroxytryptamine (5-ht) and selected neuropeptide immunoreactivities (irs). irs for pancreatic polypeptide (pp), peptide yy (pyy) and fmrfamide were found in the central nervous systems of the three species of cercariae, immunostaining the paire ... | 1994 | 7971925 |
| [development of early larval forms of moniezia expansa under laboratory conditions]. | three species of oribatid mites: scheloribates latipes, pergalumna nervosa and ceratozetes sp. were experimentally infected with moniezia expansa eggs or oncospheres. the intermediate hosts were kept under constant laboratory conditions at 27 degrees c and 80% relative humidity. three species of oribatid mites became infected and completely developed cestode cysticercoids were found. the early part of life cycle of m. expansa was studied in s. latipes. the mites were examined on 20th, 24th and 2 ... | 1994 | 7975653 |
| distribution and immunochemical characteristics of neuropeptide f (npf) (moniezia expansa) - immunoreactivity in proteocephalus pollanicola (cestoda: proteocephalidea). | 1. using immunocytochemical techniques and confocal scanning laser microscopy, the proteocephalidean cestode, proteocephalus pollanicola from lough neagh pollan (coregomus autumnalis) was examined for the presence of the native platyhelminth neuropeptide, neuropeptide f (npf). 2. an antiserum specific for whole-molecule npf (1-39) (moniezia expansa) did not immunostain nerve processes in p. pollanicola. a c-terminally-directed npf (30-39) (m. expansa) antiserum immunostained nerve fibres and cel ... | 1993 | 8103428 |
| immunocytochemical distribution of neuropeptide f (npf) in the gastropod mollusc, helix aspersa, and in several other invertebrates. | the distribution of neuropeptide f (npf) immunoreactivity in the snail, helix aspersa, has been demonstrated by immunocytochemistry using 2 region-specific antisera. one, designated npf3, was raised against a synthetic n-terminal fragment of helix aspersa npf; the other, designated pp221, was raised against the c-terminal hexapeptide amide of mammalian pancreatic polypeptide (pp) but cross-reacts fully with the analogous c-terminal region of helix aspersa npf. the distribution of npf immunoreact ... | 1994 | 8111844 |
| neuropeptide f-immunoreactivity in the tetrathyridium of mesocestoides corti (cestoda: cyclophyllidea). | the distribution pattern and subcellular localisation of neuropeptide f (npf) immunoreactivity (ir) in the tetrathyridium stage of mesocestoides corti were investigated by whole-mount immunocytochemistry in conjunction with confocal scanning laser microscopy (cslm) and by immunoelectron microscopy using immunogold labeling. using an antiserum directed to the c-terminal decapeptide amide (residues 30-39) of synthetic npf (moniezia expansa), cslm revealed npf-ir throughout the central and peripher ... | 1993 | 8295907 |
| the cholinergic, serotoninergic and peptidergic components of the nervous system of moniezia expansa (cestoda, cyclophyllidea). | the central (cns) and peripheral (pns) nervous systems of the cyclophyllidean tapeworm, moniezia expansa, were examined for the presence of cholinergic, serotoninergic and peptidergic elements using enzyme cytochemical and immunocytochemical techniques in conjunction with light and confocal scanning laser microscopy. cholinesterase activity and 5-hydroxytryptamine- and regulatory peptide-immunoreactivities (irs) were localized to the nerve fibres and cell bodies of all of the major neuronal comp ... | 1993 | 8316439 |
| gnffrfamide: a novel fmrfamide-immunoreactive peptide isolated from the sheep tapeworm, moniezia expansa. | the widespread distribution of fmrfamide-immunoreactivity in platyhelminth nervous systems has been demonstrated immunocytochemically. here we report the isolation and primary structure of the first platyhelminth fmrfamide-related peptide (farp) from the tapeworm, moniezia expansa. the peptide was found to have a molecular mass of 785 da and a primary structure of gly-asn-phe-phe-arg- phe-nh2 (gnffrfamide). acid alcohol extracts of this platyhelminth contained only this single farp which had a p ... | 1993 | 8323531 |
| electron immunogold labeling of regulatory peptide immunoreactivity in the nervous system of moniezia expansa (cestoda: cyclophyllidea). | an electron immunogold-labeling technique was used in conjunction with a post-embedding procedure to demonstrate for the first time the ultrastructural distribution of the parasitic platyhelminth neuropeptide, neuropeptide f (npf), in the nervous system of the cestode moniezia expansa. two axon types, distinguished by their populations of different-sized electron-dense vesicles, were identified. immunogold labeling demonstrated an apparent homogeneity of pp, fmrfamide and npf (m. expansa) antige ... | 1993 | 8415547 |
| platyhelminth fmrfamide-related peptides. | platyhelminths are the most primitive metazoan phylum to possess a true central nervous system, comprising a brain and longitudinal nerve cords connected by commissures. additional to the presence of classical neurotransmitters, the nervous systems of all major groups of flatworms examined have widespread and abundant peptidergic components. decades of research on the major invertebrate phyla, mollusca and arthropoda, have revealed the primary structures and putative functions of several familie ... | 1996 | 8773520 |
| ultrastructure of the surface structures and electron immunogold labeling of peptide immunoreactivity in the nervous system of pseudothoracocotyla indica (polyopisthocotylea: monogenea). | transmission electron microscope studies of the tegument of the tropical marine fish monogenean parasite pseudothoracocotyla indica describe surface specialisations and detail the ultrastructure of the tegument and the haptor. the tegument consists of a syncytium, numerous electron-dense granules, electron-lucent vesicles and large multivesicular bodies. the posterior tegumental syncytium is infolded to form tegumental ridges that are present on both the ventral and dorsal surfaces. a thin coat ... | 1996 | 8875573 |
| prevalence and seasonal changes in the gastro-intestinal helminths of nigerian goats. | a total of 120 gastro-intestinal tracts and 960 faecal samples were examined to assess the prevalence and seasonal changes in the gastro-intestinal helminth parasites of red sokoto (maradi) goats slaughtered at ibadan between may 1991 and april 1992. egg types of strongyles, strongyloides, trichuris, skrjabinema, dicrocoelium and moniezia were encountered in 93%, 83%, 44%, 0.9%, 2.3% and 31% of the faecal samples respectively. however, only strongyle, strongyloides and trichuris eggs occurred in ... | 1996 | 8960229 |
| cholinergic, serotoninergic and peptidergic components of the nervous system of discocotyle sagittata (monogenea:polyopisthocotylea). | cholinergic, serotoninergic (5-ht) and peptidergic neuronal pathways have been demonstrated in both central and peripheral nervous systems of adult discocotyle sagittata, using enzyme histochemistry and indirect immunocytochemistry in conjunction with confocal scanning laser microscopy. antisera to 2 native flatworm neuropeptides, neuropeptide f and the fmrfamide-related peptide (farp), gnffrfamide, were employed to detect peptide immunoreactivity. the cns is composed of paired cerebral ganglia ... | 1996 | 9024885 |
| comparative analysis of the distribution of bradykinin-, gyirfamide- and neuropeptide f-like immunoreactivities in the monogenean, diclidophora merlangi. | an indirect immunocytochemical technique combined with confocal scanning laser microscopy has been used to demonstrate immunoreactivities to the nonapeptide, rppgfspfr (bradykinin, bk) and the endogenous flatworm regulatory peptide, gyirfamide in the nervous system of the monogenean, diclidophora merlangi. in addition, a simultaneous double-labelling technique was employed to examine possible co-localization of gyirfamide- and neuropeptide f (npf) immunoreactivities, using antisera to the c-term ... | 1997 | 9149417 |
| physiological effects of platyhelminth fmrf amide-related peptides (farps) on the motility of the monogenean diclidophora merlangi. | the actions of known platyhelminth farps on the contractility of whole-worm preparations of the monogenean, diclidophora merlangi have been examined in vitro for the first time. all of the peptides tested had excitatory effects on the motor activity of the worm. the order of potency for the peptides tested was: yirfamide > gyirfamide = ryirfamide > gnffrfamide = flrfamide. however, although yirfamide was more potent than gyirfamide, the latter was the most efficacious on each of the motility par ... | 1997 | 9300465 |
| the nervous system of tricladida. i. neuroanatomy of procerodes littoralis (maricola, procerodidae): an immunocytochemical study. | the organization of the nervous system of procerodes littoralis (tricladida, maricola, procerodidae) was studied by immunocytochemistry, using antibodies to authentic flatworm neuropeptide f (npf) (moniezia expansa). compared to earlier investigations of the neuroanatomy of tricladid flatworms, the pattern of npf immunoreactivity in procerodes littoralis reveals differences in the following respects: 1. shape and structure of the brain. 2. number and composition of longitudinal nerve cords. 3. s ... | 1995 | 9372136 |
| characterisation and properties of an intracellular lipid-binding protein from the tapeworm moniezia expansa. | the tapeworm moniezia expansa contains an extremely abundant cytoplasmic lipid-binding protein (lbp). it is a small protein consisting of 66 amino acids with a molecular mass of 7943 +/- 1.5 da. the amino acid sequence has been established by edman degradation and confirmed by pcr analysis. the moniezia lbp shows no sequence similarity with any previously described binding protein, but does show similarity with antigen b from echinococcus glanulosus and echinococcus multilocularis and with taeni ... | 1997 | 9428673 |