| listeriolysin genes: complete sequence of ilo from listeria ivanovii and of lso from listeria seeligeri. | the complete dna sequences coding for the thiol-activated cytolysins from listeria ivanovii, ivanolysin o (ilo) and for seeligerolysin o (lso) from listeria seeligeri have been determined. the deduced amino acid sequences revealed that: (i) the primary translation products comprise 528 (ilo) and 530 (lso) amino acids, respectively, (ii) ilo contains two cysteines, lso has a substitution in the conserved cysteine motif. | 1992 | 1543752 |
| bovine abortions attributable to listeria ivanovii: four cases (1988-1990). | during a 3-year period, 4 cases of bovine abortion attributable to listeria ivanovii were diagnosed from 243 bovine fetuses submitted for diagnostic evaluation. listeria monocytogenes was isolated only once from a bovine fetus during this same time period. pathologic findings were similar to those seen in abortions attributable to l monocytogenes. consistent management factors were not recognized and breed susceptibility was not apparent. listeria ivanovii is most often associated with abortions ... | 1992 | 1568917 |
| differentiation of listeria monocytogenes, listeria innocua, listeria ivanovii, and listeria seeligeri by pulsed-field gel electrophoresis. | clamped homogeneous electric field analysis of listeria dna with apai, asci, smai, or noti revealed species- and serotype-specific differences in genomic fingerprints. clamped homogeneous electric field analysis may prove useful, therefore, in epidemiologic studies. also, the summation of individually sized asci fragments of genomic dna from l. monocytogenes serotype 4b 101m and scott a indicated genome lengths of 2,925 and 3,046 kb, respectively. | 1992 | 1610193 |
| hemolytic interactions of dermatophilus congolensis. | the strains of dermatophilus congolensis grew on blood agar with washed sheep erythrocytes with marked total hemolysis. in testing for hemolytic interactions they gave a significant synergistic effect of a characteristic shape with rhodococcus equi and streptococcus agalactiae, whereas with staphylococcus aureus producing beta hemolysin and with staphylococcus aureus producing delta hemolysin a simultaneous synergistic as well as antagonistic effect were observed. first of all a conspicuous inhi ... | 1992 | 1621476 |
| cloning and expression in escherichia coli of a gene encoding superoxide dismutase from listeria ivanovii. | a chromosomal dna fragment from the gram-positive bacterium listeria ivanovii (atcc 19119) encoding a superoxide dismutase (sod) gene has been cloned in escherichia coli qc779 (sodasodb) using the plasmid vector ptz19r. the dna fragment inserted into the plasmid showed high structural instability in e. coli qc779 (reca+), but turned out to be a stable 1.95 kbp dna fragment when transformed into e. coli dh5 alpha (reca-). the gene is expressed in both of these e. coli strains at high levels. prel ... | 1991 | 1649098 |
| phylogenetic analysis of the genus listeria based on reverse transcriptase sequencing of 16s rrna. | the phylogenetic interrelationships of members of the genus listeria were investigated by using reverse transcriptase sequencing of 16s rrna. the sequence data indicate that at the intrageneric level the genus listeria consists of the following two closely related but distinct lines of descent: (i) the listeria monocytogenes group of species (including listeria innocua, listeria ivanovii, listeria seeligeri, and listeria welshimeri) and (ii) the species listeria grayi and listeria murrayi. at th ... | 1991 | 1713054 |
| cloning of a superoxide dismutase gene from listeria ivanovii by functional complementation in escherichia coli and characterization of the gene product. | a gene encoding superoxide dismutase (ec 1.15.1.1., sod) was isolated from a plasmid library of chromosomal dna from listeria ivanovii by functional complementation of an sod-negative escherichia coli host. the nucleotide sequence of the cloned gene was determined and contained an open reading frame which codes for a protein of 202 amino acid residues (calculated molecular weight 22755 da including the amino-terminal methionine residue). comparison of the deduced amino acid sequence of l. ivanov ... | 1992 | 1736100 |
| sensitive and specific detection of listeria monocytogenes in milk and ground beef with the polymerase chain reaction. | a sensitive and specific method for detection of listeria monocytogenes in milk and ground-beef samples is described. it consists of culturing samples in listeria enrichment broth (leb) and subculturing them from leb to listeria plating media, followed by dna extraction and species-specific detection of the organism by using the polymerase chain reaction (pcr). in developing the l. monocytogenes pcr assay, five oligonucleotide primers complementary to the nucleotide sequence of the listeriolysin ... | 1991 | 1768130 |
| listeria in effluents from the food-processing industry. | there is general agreement that listeriosis has a significant impact on man as well as on animals. listeria monocytogenes has been isolated from the faeces of healthy human and animal carriers and from various environmental sources. l. monocytogenes is the pathogenic species most responsible for abortion, septicaemia and meningitis in animals and man. listeria ivanovii is a primary cause of abortion in animals. owing to a number of epidemics and single cases caused by food contaminated with l. m ... | 1991 | 1782429 |
| taxonomy of the genus listeria by using multilocus enzyme electrophoresis. | seventy-three strains of the seven recognized listeria species were studied by performing a multilocus enzyme electrophoresis analysis of 18 enzyme loci. the mean number of alleles per locus was 9.5 and all of the loci were polymorphic. a total of 56 electrophoretic types were distinguished. cluster analysis of a matrix of the genetic distances between paired electrophoretic types revealed that there were six principal clusters at the species level (genetic distances between clusters greater tha ... | 1991 | 1899799 |
| evaluation of hybridization characteristics of a cloned prf106 probe for listeria monocytogenes detection and development of a nonisotopic colony hybridization assay. | an internal fragment (prf106 fragment, ca. 500 bp) of a gene (msp) coding for a 60-kda protein of listeria monocytogenes serotype 1/2a was used to develop a screening method to discriminate between l. monocytogenes and avirulent listeria spp. on primary isolation plates. the l. monocytogenes-derived probe fragment of prf106 hybridized to a 13-kb fragment of l. monocytogenes and a 3-kb fragment of one cheese isolate strain of listeria seeligeri under stringent hybridization conditions (mean therm ... | 1991 | 1903627 |
| cytopathogenic effects in enterocytelike caco-2 cells differentiate virulent from avirulent listeria strains. | we have developed a simple test that differentiates between virulent and avirulent listeria species as defined by the mouse 50% lethal doses (ld50s). the assay is based on trypan blue-revealed cytopathogenic effects that are produced during the infection of the human enterocytelike cell line caco-2. these effects were elicited only by listeria strains that had an intraperitoneal mouse ld50 less than 10(8) and were not produced by nonhemolytic, avirulent strains of listeria monocytogenes generate ... | 1991 | 1905323 |
| antagonistic effect of coryneform bacteria from red smear cheese against listeria species. | a total of 187 coryneform bacteria were isolated from red smear and screened for inhibitory effects against 16 strains of listeria species. culture filtrates from brevibacterium linens (16 strains), arthrobacter nicotianae (4 strains) and arthrobacter nucleogenes (3 strains) showed clear zones of inhibition. the antagonistic effect was seen against 26 to 87% of 91 listeria strains tested. a. nicotianae and a. nucleogenes were more effective against listeria innocua and listeria ivanovii than aga ... | 1991 | 1909545 |
| production and characterization of neutralizing and nonneutralizing monoclonal antibodies against listeriolysin o. | listeriolysin o (llo) is a thiol-activated toxin secreted by the facultative intracellular pathogen listeria monocytogenes. llo is essential for the survival of the bacterium in the infected cell because it promotes lysis of the phagosome membrane and escape of the bacterium into the cytosol. llo was used as an antigen for the production of nine monoclonal antibodies (mabs) in mice. three of these could inhibit the hemolytic activity of llo. one of them inhibited binding of llo to erythrocyte me ... | 1991 | 1937824 |
| abortions in sheep due to listeria ivanovii. | | 1991 | 2018457 |
| in vitro antimicrobial susceptibility of listeria monocytogenes isolated in the uk and other listeria species. | the mics and mbcs of 21 antimicrobial agents were determined for 103 strains of listeria monocytogenes isolated in the uk and 27 strains of other listeria species. ampicillin, penicillin, azlocillin, imipenem, gentamicin, netilmicin, amikacin, erythromycin, rifampicin, trimethoprim, clindamycin and vancomycin had good activity, while cephalothin, chloramphenicol, ciprofloxacin and ofloxacin were less active, and cefuroxime, enoxacin, norfloxacin and fosfomycin were the least active. tetracycline ... | 1990 | 2124539 |
| haematological reactions of rabbits infected intravenously with listeria strains of different virulence. | listeria strains of different virulence were injected intravenously into rabbits of both sexes (2-4 kg). the infectious dose was 10(8) cells/kg. blood samples were taken from the ear wein one day and immediately before the infection, then 3 h, 1, 2, 3, 6 and 10 days after it. total white blood cell counts and their changes were determined and the number of lysosomal granules in neutrophils were counted. a marked monocytic reaction was observed after the injection of virulent listeria monocytogen ... | 1990 | 2124767 |
| [isolation of listeria ivanovii in slovakia]. | from october 1977 to may 15, 1989 in slovakia 39 strongly haemolytic strains of l. ivanovii were isolated from a woman after delivery of a stillborn foetus--from the lochiae, placenta and rectal smear, from five symptom-free subjects from the faeces, from the rectal smears of two sheep, from the intestinal contents in the portion of the terminal ileus from 28 free living small terrestrial mammals, one strain from meat--beef steak, from the lungs, liver and kidneys of a dead young sheep and one s ... | 1990 | 2150609 |
| characterization of a listeria monocytogenes-specific protein capable of inducing delayed hypersensitivity in listeria-immune mice. | recovery of the host after infection by the intracellular pathogen listeria monocytogenes is dependent on cell-mediated immunity. little is known of the nature of listerial antigens that induce cell-mediated responses in the infected host. in this study we report on the identification and cloning of an escherichia coli recombinant encoding a listerial antigen, designated imaa, capable of eliciting a specific delayed-type hypersensitivity response in listeria-immune mice. nucleotide sequencing of ... | 1990 | 2172692 |
| revision of the validity of camp tests for listeria identification. proposal of an alternative method for the determination of haemolytic activity by listeria strains. | the validity of camp tests with staphylococcus aureus and rhodococcus (corynebacterium) equi as defined for listeria identification was revised. this characterization method appeared to be unreliable for two reasons: first, a positive camp test with r. equi is not specific for listeria ivanovii as listeria monocytogenes (and listeria seeligeri) give also a clear positive reaction; second, doubtful reactions could be observed with s. aureus when assaying haemolytic and non-haemolytic listeria str ... | 1990 | 2270739 |
| functional similarity of listeria ivanovii and staphylococcus aureus in camp test. | on the basis of synergistic haemolysis of listeria ivanovii and rhodococcus equi, we suspected camp positiveness of r. equi and complete camp negativeness of l. ivanovii and confirmed that the latter, showing a double-zone haemolysis like staphylococcus aureus, could produce the same phenomenon in the camp test if used instead of staphylococci. this functional similarity of l. ivanovii and camp staphylococcus could be used as an additional diagnostic test for l. ivanovii. | 1990 | 2400534 |
| the place of listeria among gram-positive bacteria. | the genus listeria, containing the species listeria monocytogenes, listeria innocua, listeria seeligeri, listeria welshimeri, listeria ivanovii, listeria grayi and listeria murrayi is a well circumscribed taxon. numerical taxonomic and chemical studies indicate a very close phenetic similarity to the genus brochothrix and a more distant, but close, similarity to a number of other genera such as lactobacillus, streptococcus, lactococcus, enterococcus, staphylococcus, kurthia and bacillus. recent ... | 1988 | 2458321 |
| taxonomy of the genus listeria. | according to dna homology values as well as to 16s rrna cataloguing results, the genus listeria presently contains two groups of closely related species: one is constitued by listeria gravi and listeria murrayi, the other by listeria monocytogenes, listeria ivanovii, listeria innocua, listeria welshimeri, and listeria seeligeri. among these seven species, only two are pathogenic for humans and animals: listeria monocytogenes and listeria ivanovii. listeria denitrificans was recently excluded fro ... | 1988 | 2458322 |
| production, purification and characterization of hemolysins from listeria ivanovii and listeria monocytogenes sv4b. | in culture supernatants of both listeria ivanovii and listeria monocytogenes sv4b, for the first time a hemolysin of molecular weight 58 kda was identified, which had all the characteristics of an sh-activated cytolysin, and which was therefore identified as listeriolysin o (llo). in the case of l. ivanovii a second major supernatant protein of molecular weight 24 kda co-purified with llo. however, the function of this protein has to be determined. in culture supernatants of l. ivanovii a sphing ... | 1989 | 2498153 |
| cloning of a gene encoding a major secreted polypeptide of listeria monocytogenes and its potential use as a species-specific probe. | a gene, designated msp, that encodes a major secreted polypeptide with a molecular mass of approximately 60 kilodaltons (kda) was cloned from listeria monocytogenes 10403. dna hybridization analysis indicated that the msp gene was highly conserved among 15 independent l. monocytogenes isolates and that each of 5 isolates tested secreted a 60-kda polypeptide that was immunologically related to the msp gene product. dna sequences related to msp were not detected in any other listeria species or in ... | 1989 | 2508555 |
| production of thiol-dependent haemolysins by listeria monocytogenes and related species. | twenty-six strains belonging to the five main species of the genus listeria were examined for production of thiol-dependent exotoxins. all strains of l. monocytogenes cultured in charcoal-treated broth secreted a haemolytic factor at a level ranging from 200 to 800 haemolytic units (hu) ml-1, except for the strain egd (1500 hu ml-1) and the type strain cip 82110t (10 hu ml-1). the haemolytic activity reached a maximum level by 8-10 h and then rapidly declined as soon as bacterial exponential gro ... | 1989 | 2516113 |
| purification and characterization of two listeria ivanovii cytolysins, a sphingomyelinase c and a thiol-activated toxin (ivanolysin o). | the strong bizonal hemolysis on blood agar and the positive camp reaction with rhodococcus equi denotes the production of two different cytolytic factors by listeria ivanovii. one was characterized as a thiol-activated (sh) cytolysin of 61 kilodaltons and was termed ivanolysin o (ilo) since data suggested that it is different from listeriolysin o, the sh-cytolysin produced by listeria monocytogenes. the other is a 27-kilodalton hemolytic sphingomyelinase c that was found to be the cytolytic fact ... | 1989 | 2553614 |
| purification and characterization of cytolysins from listeria monocytogenes serovar 4b and listeria ivanovii. | several exoproteins from listeria monocytogenes serovar 4b (nctc 10527) and listeria ivanovii (atcc) 19119, slcc 2379), respectively, have been purified to homogeneity by thiol-disulfide exchange chromatography and gel filtration. both strains produce a haemolytic/cytolytic protein of mr 58 kda, which has all the properties of a sh-activated cytolysin, the prototype of which is streptolysin o (slo), and this protein has therefore been termed listeriolysin o (llo). in addition a protein of mr 24 ... | 1989 | 2561038 |
| phospholipase c in listeria. | the cooperative and antagonistic effect of extracellular bacterial proteins of streptococcus agalactiae, rhodococcus equi, corynebacterium ovis, and corynebacterium haemolyticum with proteins of listerial strains of various sources, species and serovars of the membrane of sheep erythrocytes was investigated. listeria monocytogenes and listeria ivanovii produce, beside listeriolysin, further proteins. their specific effect on the sheep erythrocyte membrane becomes apparent after the appearance of ... | 1989 | 2561039 |
| isolation and characterization of genes coding for proteins involved in the cytolysis by listeria ivanovii. | we established a library of chromosomal dna of listeria ivanovii in the ptz19r plasmid system, using escherichia coli dh5 alpha as the host. one recombinant clone reacted strongly with a polyclonal antiserum raised against the listeriolysin o and a second exoprotein (24kda) of l. ivanovii, which is most probably also involved in cytolytic processes. the recombinant e. coli clone may contain part of the listeriolysin o gene of l. ivanovii. | 1989 | 2631506 |
| gene probes for the detection of listeria spp. | four cloned genes of listeria monocytogenes coding for listeriolysin o, beta-haemolysin, camp-factor and a dth-inducing protein (dth-18) were used as gene probes in dna-dna hybridization with different listerial references strains. the fragment encoding for dth-18 is the only probe reacting specifically with pathogenic strains of l. monocytogenes and listeria ivanovii. | 1989 | 2631507 |
| specific gene probe for detection of biotyped and serotyped listeria strains. | a total of 284 strains of listeria, including all known serovars and biovars together with listeria grayi and listeria murrayi, were biotyped and serotyped. biotyping and serotyping could be done in 2 days. a gene probe encoding a delayed hypersensitivity factor (dth) was used in the detection of pathogenic biotypes and serotypes of the tested strains. the gene was found in all 117 tested listeria monocytogenes strains of serogroups 1/2a, 1/2b, 1/2c, 3a, 3b, 3c, 4c, 4d, 4e, 4ab, and 7. it was al ... | 1989 | 2658807 |
| detection of listeriolysin, the thiol-dependent hemolysin in listeria monocytogenes, listeria ivanovii, and listeria seeligeri. | the listeriolysin gene from a weakly hemolytic but virulent strain of listeria monocytogenes serotype 1/2a was cloned in escherichia coli k-12. recombinants were identified on the basis of their cross-reactivities to hyperimmune antisera raised against streptolysin o and listeriolysin. low levels of hemolytic activity were detected in crude lysates of strains harboring the listeriolysin gene. in dna hybridization studies with five dna probes that encoded the listeriolysin gene and surrounding se ... | 1989 | 2744850 |
| production of listeriolysin by beta-hemolytic strains of listeria monocytogenes. | listeriolysin was isolated from target rabbit erythrocyte membranes after lysis of the cells with partially purified toxin derived from a culture supernatant of listeria ivanovii. the membrane form of the toxin exhibited properties similar to those previously found for streptolysin o. detergent-solubilized, delipidated listeriolysin was found to comprise a heterogeneous population of partially and fully circularized, amphiphilic oligomers whose embedment within the lipid bilayer generated large ... | 1986 | 3079734 |
| microplate technique to determine hemolytic activity for routine typing of listeria strains. | because the hemolysis produced by listeria monocytogenes and listeria seeligeri on blood agar is frequently difficult to interpret, we developed a microplate technique for the routine determination of hemolytic activity with erythrocyte suspensions. this microtechnique is a simple and reliable test for distinguishing clearly between hemolytic and nonhemolytic strains and could be used instead of the camp (christie-atkins-munch-petersen) test with staphylococcus aureus in the routine typing of li ... | 1986 | 3088037 |
| potential use of continuous cell lines to distinguish between pathogenic and nonpathogenic listeria spp. | continuous cell lines were tested for their potential use in distinguishing pathogenic from nonpathogenic listeria species. listeria monocytogenes and listeria ivanovii strains were lethal for mice, and culture filtrates were cytotoxic for cultured cells and hemolytic for sheep erythrocytes, while listeria innocua, listeria grayi, and listeria murrayi strains were negative in all three tests. the eight cell lines tested were all affected but varied in sensitivity, with the chinese hamster ovary ... | 1987 | 3114320 |
| in vitro model of penetration and intracellular growth of listeria monocytogenes in the human enterocyte-like cell line caco-2. | penetration and replication of listeria monocytogenes within intestinal epithelial cells were studied by infecting the human enterocyte-like cell line caco-2. entry was due to directed phagocytosis, as suggested by the inhibiting effect of cytochalasin d on bacterial entry and by electron microscopy showing bacteria inside membrane-limiting vacuoles at the early stage of infection. only bacteria from pathogenic species (l. monocytogenes and listeria ivanovii) were able to induce their own phagoc ... | 1987 | 3117693 |
| microcalorimetric investigations on listeria. | sixty-one listeria strains--listeria monocytogenes (35 strains), listeria ivanovii (8), listeria innocua (7), listeria welshimeri (6) and listeria seeligeri (5)--were tested microcalorimetrically for their heat production upon growth in columbia broth. listeria ivanovii and listeria seeligeri displayed different and quite characteristic thermograms. listeria welshimeri, listeria innocua and all but one of the listeria monocytogenes strains showed similar microcalorimetric curves, which differed ... | 1988 | 3134766 |
| pathogenicity of listeria monocytogenes in comparison to other listeria species. | in different mouse models the pathogenicity of various strains of listeria monocytogenes and of other listeria spp. was evaluated. although quantitative differences of virulence among strains of l. monocytogenes are found, all isolates have to be regarded pathogenic unless essential virulence factors, such as protein composition of the cell wall or hemolysin production, are lacking. besides l. monocytogenes, only listeria ivanovii is able to multiply in the murine host, though definitely to a le ... | 1988 | 3138187 |
| hemolysin from listeria--biochemistry, genetics and function in pathogenesis. | thiol-activated hemolysins (listeriolysins) from listeria monocytogenes (sv4b) and listeria ivanovii were purified to homogeneity. the n-terminal amino acid sequences of the 58 kda listeriolysin of l. ivanovii and of a 24 kda protein which may represent the camp-factor of l. ivanovii were determined. antibodies raised against the l. ivanovii listeriolysin and anti-streptolysin o antibodies were used in western blot analyses to detect listeriolysin(s) in virulent and avirulent listeria strains. i ... | 1988 | 3138189 |
| [isolation of micro-organisms of the species listeria from raw milk intended for human consumption]. | refrigerated mixtures of raw milk provided by a dairy which was supplied by farms from west and central spain were tested for the presence of listeria microorganisms. a total of 95 samples were taken at regular intervals over a 16-month period. listeria grayi was isolated from 89.5% of the samples, listeria monocytogenes s. str. from 45.3%, listeria innocua from 15.8%, listeria welshimeri from 3.1%, and listeria seeligeri from 1.05%. listeria ivanovii, listeria murrayi, and listeria denitrifican ... | 1985 | 4063881 |
| the actin-polymerization protein from listeria ivanovii is a large repeat protein which shows only limited amino acid sequence homology to acta from listeria monocytogenes. | | 1995 | 7590161 |
| the actin-polymerization protein from listeria ivanovii is a large repeat protein which shows only limited amino acid sequence homology to acta from listeria monocytogenes. | within infected eukaryotic cells the two pathogenic listeria species, l. monocytogenes and l. ivanovii, induce polymerization of cellular actin and the formation of a propulsive actin tail at one bacterial pole. for l. monocytogenes it has been shown that the product of the listerial acta gene is required for this process which is regarded as a model for actin-based motility. we have now cloned and sequenced a functionally analogous gene from l. ivanovii; its product, as deduced from the dna seq ... | 1995 | 7705602 |
| a focal adhesion factor directly linking intracellularly motile listeria monocytogenes and listeria ivanovii to the actin-based cytoskeleton of mammalian cells. | the surface-bound acta polypeptide of the intracellular bacterial pathogen listeria monocytogenes is the sole listerial factor needed for recruitment of host actin filaments by intracellularly motile bacteria. here we report that following listeria infection the host vasodilator-stimulated phosphoprotein (vasp), a microfilament- and focal adhesion-associated substrate of both the camp- and cgmp-dependent protein kinases, accumulates on the surface of intracytoplasmic bacteria prior to the detect ... | 1995 | 7729410 |
| iacta of listeria ivanovii, although distantly related to listeria monocytogenes acta, restores actin tail formation in an l. monocytogenes acta mutant. | a gene homologous to the acta gene of listeria monocytogenes was cloned from listeria ivanovii (strain clip257) by chromosome walking starting from the ilo gene that encodes the pore-forming toxin ivanolysin. the nucleotide sequence revealed that this gene, named iacta, encodes a protein of 1,044 amino acids (iacta) comprising a central region with seven highly conserved tandem proline-rich repeats of 47 amino acids. although iacta and acta share an overall similar structure, these two proteins ... | 1995 | 7790091 |
| listeria ivanovii infection. | | 1994 | 7806889 |
| protein tyrosine kinase inhibitors block the entries of listeria monocytogenes and listeria ivanovii into epithelial cells. | the internalization of listeria by intestinal epithelial cells is still poorly understood, however it is becoming apparent that microorganisms have developed the ability to interact with host cell receptor molecules to induce their own internalization. in this report we show that inhibition of cell tyrosine phosphorylation by protein tyrosine kinase (ptk) inhibitors blocks l. monocytogenes entry into both finite and immortalized intestinal cell lines. some differences were observed between the l ... | 1994 | 7861952 |
| the virulence regulator protein of listeria ivanovii is highly homologous to prfa from listeria monocytogenes and both belong to the crp-fnr family of transcription regulators. | the two pathogenic listeria species, l. ivanovii and l. monocytogenes, can be differentiated biochemically and show different host ranges. virulence of l. monocytogenes is dependent on the integrity of prfa which positively and co-ordinately regulates transcription of several virulence genes. until now, a prfa homologue had not been identified in l. ivanovii. we have now cloned a chromosomal region from l. ivanovii comprising two genes with high homology to the plca and prfa genes from l. monocy ... | 1994 | 7984088 |
| the virulence gene cluster of listeria monocytogenes is also present in listeria ivanovii, an animal pathogen, and listeria seeligeri, a nonpathogenic species. | most known listeria monocytogenes virulence genes cluster within a 9.6-kb chromosomal region. this region is flanked on one end by two uncharacterized open reading frames (orf a and orf b) and ldh, an orf presumably encoding the l. monocytogenes lactate dehydrogenase (j.-a. vazquez-boland, c. kocks, s. dramsi, h. ohayon, c. geoffroy, j. mengaud, and p. cossart, infect. immun. 60:219-230, 1992). we report here that the other end is flanked by prs, and orf homologous to phosphoribosyl ppi syntheta ... | 1994 | 8039927 |
| differentiated u937 cells exhibit increased bactericidal activity upon lps activation and discriminate between virulent and avirulent listeria and brucella species. | in the study of interactions between facultative intracellular pathogens and macrophages, monocytic cell lines have the advantages of showing defined states of activation and lacking genetic variation among donors, thus yielding reproducible results. nonpathogenic escherichia coli k12 were killed at similar rates in the u937 cell line differentiated into macrophage-like cells by phorbol myristate acetate (pma) or by the combination of retinoic acid (ra) and vitamin d3 (vd). complete elimination ... | 1994 | 8071593 |
| listeria ivanovii infection in a patient with aids. | we describe a case of bacteraemia due to listeria ivanovii in a patient with aids. this organism is a rare human pathogen. | 1994 | 8163840 |
| interaction of listeria species with human cell monolayers. | in foodborne listeriosis, the first step of infection must be attachment to, and invasion of, the gastrointestinal epithelium by virulent listeria monocytogenes. virulence factors affecting this invasion are only now being determined. we examined the interaction of l. monocytogenes, serotypes 4b and 1/2a strains with "smooth" and "rough" characteristics. in addition, flagellated and non-flagellated isogenic strains altered by transposon mutagenesis were examined to study the effect of flagellae ... | 1994 | 8174317 |
| purification of helicobacter pylori superoxide dismutase and cloning and sequencing of the gene. | the superoxide dismutase (sod) of helicobacter pylori, a pathogenic bacterium which colonizes the gastric mucosa, evoking a marked inflammatory response, was purified and characterized, and the n-terminal amino acid sequence was determined. the enzyme consists of two identical subunits each with an apparent molecular weight of 24,000. analysis of the primary structure and inhibition studies revealed that h. pylori possesses a typical procaryotic iron-containing enzyme. no other isoenzymes could ... | 1993 | 8225605 |
| listeria ivanovii is capable of cell-to-cell spread involving actin polymerization. | listeria ivanovii has been considered to be pathogenic to animals but has rarely been found associated with human infections. it has been claimed that l. ivanovii lacks the acta gene, which in l. monocytogenes encodes a protein required for interaction with host cell actin. using fluorescence microscopy and electron microscopy, we demonstrate that l. ivanovii can invade mammalian cells, lyse the phagosomal membrane, polymerize host cell actin, reorganize actin to form tails, and spread from cell ... | 1993 | 8418038 |
| genetic basis of tetracycline resistance in food-borne isolates of listeria innocua. | eleven of 12 tetracycline-resistant listeria innocua strains, isolated from chicken or turkey frankfurters and mozzarella cheese, were shown to carry dna sequences which hybridized with the tet m probe; of these, two strains also hybridized with tet k. the remaining strain hybridized with the tet k probe only. the tet m determinant appeared to be located on the chromosome; in one case, it was transferable by conjugation to recipients listeria monocytogenes, listeria ivanovii, and enterococcus fa ... | 1993 | 8434927 |
| a 16s rrna-based dna probe and pcr method specific for listeria ivanovii. | a 16s rrna-based dna probe and polymerase chain reaction (pcr) method was developed for identification and rapid detection of listeria ivanovii. the probe (r-1) is 5'-gtagtgacgcatgtcatcac-3' corresponding to positions 185-204 in the l. ivanovii 16s rrna sequence. dna hybridization results indicated that r-1 probe only reacted with l. ivanovii, and not with six other species of listeria or other bacteria tested. the pcr method using r-1 and a reverse primer, r-2, was positive with all eight strai ... | 1993 | 8440468 |
| transferable erythromycin resistance in listeria spp. isolated from food. | an erythromycin-resistant (emr) listeria innocua and an emr listeria monocytogenes isolate both carried ermc genes, which code for rrna methylases. the ermc genes were transferable by conjugation to recipient l. monocytogenes, listeria ivanovii, and enterococcus faecalis but did not appear to be associated with conjugative plasmids. | 1996 | 8572704 |
| genomic subtraction in combination with pcr for enrichment of listeria monocytogenes-specific sequences. | genomic dna from listeria innocua and listeria ivanovii was used in subtractive hybridization with dna from listeria monocytogenes involving two amplification strategies. subtraction was accomplished by labelling the subtracting dna with biotin and removal after liquid hybridization with tester dna (l. monocytogenes) by reaction with streptavidin and phenol extraction. in one strategy, l. monocytogenes dna was poly(a)-tailed with terminal transferase and amplified asymmetrically after subtractio ... | 1995 | 8579987 |
| in vitro conjugative transfer of vana vancomycin resistance between enterococci and listeriae of different species. | in a study designed to gain data on the in vitro transferability of vancomycin resistance from enterococci of the vana phenotype to listeriae of different species, three clinical enterococcus isolates-enterococcus faecium ls10, enterococcus faecalis ls4, and enterococcus faecalis a3208, all harboring a plasmid that strongly hybridized with a vana probe-were used as donors in transfer experiments. strains of five listeria species were used as recipients. from enterococcus faecium ls10, glycopepti ... | 1996 | 8641304 |
| identification and purification of novel internalin-related proteins in listeria monocytogenes and listeria ivanovii. | monoclonal antibodies were generated against a 30-kda protein fraction derived from culture supernatants of a listeria monocytogenes strain complemented with additional copies of the prfa regulator gene. several of the antibodies reacted specifically with a hitherto unidentified, secreted 30-kda polypeptide. by immunoblot analysis, the expression of this 30kda polypeptide was found to be dependent on the presence of the prfa regulator protein. microsequencing of peptides derived from the partial ... | 1996 | 8641748 |
| covalent structure, synthesis, and structure-function studies of mesentericin y 105(37), a defensive peptide from gram-positive bacteria leuconostoc mesenteroides. | a 37-residue cationic antimicrobial peptide named mesentericin y 105(37) was purified to homogeneity from cell-free culture supernatant of the gram-positive bacterium leuconostoc mesenteroides. the complete amino acid sequence of the peptide, kyygngvhctksgcsvnwgeaasagihrlanggngfw, has been established by automated edman degradation, mass spectrometry, and solid phase synthesis. mesentericin y 105(37) contains a single intramolecular disulfide bond that forms a 6-membered ring within the molecule ... | 1996 | 8662868 |
| the acta polypeptides of listeria ivanovii and listeria monocytogenes harbor related binding sites for host microfilament proteins. | the surface-bound acta polypeptide of the intracellular bacterial pathogen listeria monocytogenes acts as a nucleator protein, generating the actin cytoskeleton around intracellularly motile bacteria. in this work, we examined the functional similarity of acta from listeria ivanovii (iacta) atcc 19119 to its l. monocytogenes counterpart. the amino acid sequence of iacta predicts a molecular mass of 123 kda and harbors eight proline-rich repeats. for functional analysis, various iacta derivatives ... | 1996 | 8675289 |
| comparison of the infectivity of isolates of listeria monocytogenes following intragastric and intravenous inoculation in mice. | the infectivity of 19 haemolytic isolates of listeria monocytogenes from different sources (clinical and environmental) and representative isolates from listeria ivanovii and listeria innocua was compared following intragastric (i.g.) and intravenous (i.v.) inoculation in immunocompetent male balb/c mice. there was marked variation in the infectivity of the different isolates by either route but when isolates were ranked in descending order by spleen count, following i.g. administration, the str ... | 1996 | 8737494 |
| comparative analysis of 16s and 23s rrna sequences of listeria species. | in order to establish the taxonomic value of 16s rrna and 23s rrna for distinguishing listeria species, the complete 23s rrna sequences for all listeria species were determined by using the type strains. we designed and experimentally validated a universal 23s rrna sequencing method, which included pcr amplification of the rdna gene and direct cycle sequencing of the amplicon with eubacterial primers. the results of our sequence comparison indicated that the genus listeria can be divided into tw ... | 1996 | 8782674 |
| taxonomic note: a proposal for reviewing the interpretation of the camp reaction between listeria monocytogenes and rhodococcus equi. | the discrepancies between the current description of the camp test between listeria monocytogenes and rhodococcus equi in the latest edition of bergey's manual of determinative bacteriology (l. monocytogenes is described as camp test negative with r. equi) and routine findings (positive reactions are usually described in many laboratories) make it advisable to review the current interpretation of the camp test to avoid confusion among people working in microbiological laboratories. overall, 98.4 ... | 1996 | 8782698 |
| the use of listeriolysin o in an elisa, a skin test and a lymphocyte blastogenesis assay on sheep experimentally infected with listeria monocytogenes, listeria ivanovii or listeria innocua. | purified listeriolysin o (llo) was evaluated as a specific antigen to detect both humoral and cell mediated immune responses of sheep infected with listeria monocytogenes. six sheep (two in each group) were orally inoculated with 10(10) organisms of l. monocytogenes, l. ivanovii, or l. innocua. only the l. monocytogenes inoculated sheep had an elevated temperature (> 42 degrees c) and after 15 days had anti-llo antibodies as assessed by an elisa. in a blastogenesis assay, only peripheral blood m ... | 1996 | 8828131 |
| genus- and species-specific detection of listeria monocytogenes using polymerase chain reaction assays targeting the 16s/23s intergenic spacer region of the rrna operon. | in this study, the 16s/23s rrna intergenic spacer (igs) regions of six listeria species were examined. dna bands of 590 and 340 bp were observed following polymerase chain reaction (pcr) amplification of dna from listeria monocytogenes, listeria innocua, listeria seeligeri, listeria welshimeri, and listeria ivanovii strains with generic rrna igs oligonucleotide primers. for strains of listeria grayi subspp. grayi and murrayi, dna band sizes of 550 and 340 bp were observed with this primer pair. ... | 1996 | 8941989 |
| occurrence of listeria monocytogenes and other listeria spp. in raw caprine milk. | samples of caprine milk from bulk tanks of 405 farms in central spain were analyzed for listeria spp. once per season over a 1-yr period. listeria monocytogenes and listeria innocua were detected in 2.56 and 1.73% of the 1445 samples, respectively. listeria ivanovii (0.21% samples) and listeria seeligeri (0.07% samples) were rarely isolated. only 6 milk samples were contaminated by more than one listeria species. most farms (92.59%) produced milk that was apparently free from l. monocytogenes th ... | 1996 | 8961100 |
| bovine abortion caused by listeria ivanovii. | | 1997 | 9088515 |
| characterization of the vaccinia virus f8l protein. | vaccinia virus infection dramatically affects the host actin cytoskeleton by inducing disassembly of actin stress fibres and formation of actin tails which propel the virus intra- and intercellularly. the viral factors responsible for these actin rearrangements remain unknown. sequence analysis reveals significant homology between the vaccinia f8l orf and the proline repeats of iacta, the protein which initiates actin tail assembly and motility in the bacterial pathogen listeria ivanovii. we cha ... | 1997 | 9349485 |
| [polyposis of the gastrointestinal tract as a manifestation of diffuse follicular lymphatic hyperplasia]. | a 21-year-old previously healthy turkish man who had been living in germany for 15 years was admitted because of worsening cramp-like abdominal pain with nausea, vomiting and watery diarrhoea. palpation elicited diffuse muscular guarding over the entire abdomen and a mass of about 8 cm in the right lower abdomen. | 1998 | 9551038 |
| [antibacterial activity of lactobacilli]. | the antagonistic action of lactobacilli is an important factor in the protection of the vagina of fertile women from infection by other microorganisms. in the present study the authors investigated 17 strains of lactobacilli, incl. 11 of vaginal origin. the objective was to investigate in more detail the antibacterial activity of lactobacilli and to attempt to assess substances responsible for inhibition. the investigated lactobacilli inhibited some strains of escherichia coli, serratia marcesce ... | 1998 | 9611889 |
| unstable expression and thermal instability of a species-specific cell surface epitope associated with a 66-kilodalton antigen recognized by monoclonal antibody em-7g1 within serotypes of listeria monocytogenes grown in nonselective and selective broths. | conditions that resulted in unstable expression and heat instability of a cell surface epitope associated with a 66-kda antigen in listeria monocytogenes serotypes were identified with the probe monoclonal antibody (mab) em-7g1 in an enzyme-linked immunosorbent assay. this epitope appeared to be absent in three serotypes (serotypes 3b, 4a, and 4c), which did not react with mab em-7g1 irrespective of the enrichment broth tested. the remaining 10 serotypes were detected by mab em-7g1 only when cel ... | 1998 | 9687476 |
| bacterial isolates from california sea lions (zalophus californianus), harbor seals (phoca vitulina), and northern elephant seals (mirounga angustirostris) admitted to a rehabilitation center along the central california coast, 1994-1995. | in 2 yr of bacteriologic culturing of 297 california sea lions (zalophus californianus), 154 harbor seals (phoca vitulina), and 89 northern elephant seals (mirounga angustirostris) stranded alive along the california coast, the most frequent isolates from inflammatory lesions in live animals were escherichia coli, streptococcus viridans, listeria ivanovii, beta-hemolytic streptococcus spp., and enterococcus spp. this is the first report of l. ivanovii isolation from a marine mammal. the common i ... | 1998 | 9732032 |
| a novel prfa-regulated chromosomal locus, which is specific for listeria ivanovii, encodes two small, secreted internalins and contributes to virulence in mice. | several large, cell wall-associated internalins and one small, secreted internalin (inlc) have been described previously in listeria monocytogenes. using degenerate primers derived from sequenced peptides of an l. ivanovii major secreted protein, we identified a new 4.25 kb internalin locus of l. ivanovii, termed i-inlfe. the two proteins encoded by this locus, i-inle and i-inlf, belong to the group of small, secreted internalins. southern blot analyses show that the i-inlfe locus does not occur ... | 1998 | 9791184 |
| inhibition of bacterial pathogens by lactobacilli. | lactobacilli produce many antimicrobial substances including organic acids, hydrogen peroxide and bacteriocins. antagonistic activity of lactobacilli is an important factor in the protection of the vagina of fertile women against infection by certain pathogens. in the present study, we investigated 17 strains of lactobacilli, including 11 strains of vaginal origin. the aim was to investigate in more detail the antibacterial activity of lactobacilli and to attempt to assess substances responsible ... | 1998 | 9861683 |
| the gene cluster inlc2de of listeria monocytogenes contains additional new internalin genes and is important for virulence in mice. | in this work we identified and characterized a gene cluster containing three internalin genes of listeria monocytogenes egd. these genes, termed inlg, inlh and inle, encode proteins of 490, 548 and 499 amino acids, respectively, which belong to the family of large, cell wall-bound internalins. the inlghe gene cluster is flanked by two listerial house-keeping genes encoding proteins homologous to the 6-phospho-beta-glucosidase and the succinyl-diaminopimelate desuccinylase of e. coli. a similar i ... | 1998 | 9862466 |
| characterisation of listeria ivanovii isolates from the uk using pulsed-field gel electrophoresis. | forty-three listeria ivanovii isolates were collected in the uk between 1991 and 1997 from: 35 animal infections; two human infections; five foods; and one environmental source. a further two type strains of l. ivanovii (subsp. ivanovii and subsp. londoniensis) were obtained from a culture collection. these bacteria were characterised by conventional phenotypic methods and by pulsed-field gel electrophoresis (pfge) using apai and smai. forty-two of the isolates from the uk were identified as l. ... | 1999 | 9933929 |
| production of monoclonal antibodies to listeria monocytogenes and their application to determine the virulence of isolates from channel catfish. | we produced monoclonal antibodies (mabs) to the extracellular proteins of listeria monocytogenes egd grown in chelex-treated improved minimal medium. ten of the positive hybridomas generated were chosen for further characterization. seven of the mabs reacted with a protein having a molecular mass of 60 kda. these mabs inhibited listeriolysin (llo)-mediated hemolysis, and two of them were specific for llo and none of the other thiol-activated toxins tested. in an enzyme-linked immunosorbent assay ... | 1999 | 10388671 |
| the smcl gene of listeria ivanovii encodes a sphingomyelinase c that mediates bacterial escape from the phagocytic vacuole. | the ruminant pathogen listeria ivanovii differs from listeria monocytogenes in that it causes strong, bizonal haemolysis and a characteristic shovel-shaped co-operative haemolytic ('camp-like') reaction with rhodococcus equi. we cloned the gene responsible for the differential haemolytic properties of l. ivanovii, smcl. it encodes a sphingomyelinase c (smase) highly similar (> 50% identity) to the smases from staphylococcus aureus (beta-toxin), bacillus cereus and leptospira interrogans. smcl wa ... | 1999 | 10417642 |
| outbreak of listeria ivanovii abortion in sheep in india. | | 1999 | 10460032 |
| temperature gradient gel electrophoresis of the amplified product of a small 16s rrna gene fragment for the identification of listeria species isolated from food. | the development of a rapid method for the identification of listeria spp. is described. it is based on the polymerase chain reaction amplification of a small fragment from the 16s rrna gene followed by temperature gradient gel electrophoresis. forty-five strains of listeria spp. (listeria monocytogenes, listeria innocua, listeria ivanovii, listeria seeligeri, and listeria welshimeri) were used for the optimization of the protocol. no differences were observed between the results of the identific ... | 2000 | 10826726 |
| smcl, a novel membrane-damaging virulence factor in listeria. | we describe here the fourth listerial membrane-damaging virulence factor, a sphingomyelinase c (smase) that is produced specifically by the ruminant pathogen listeria ivanovii. its coding gene, smcl, is a monocistron expressed independently of prfa. the smcl product, smcl, is highly similar to the staphylococcal beta-toxin and is responsible for the differential hemolytic properties of l. ivanovii (bizonal hemolysis and camp-like reaction with r. equi). the role of smcl in virulence was assessed ... | 2000 | 11111913 |
| characterization and purification of a bacteriocin produced by a potential probiotic culture, lactobacillus acidophilus 30sc. | lactobacillus acidophilus 30sc was tested for its potential as a probiotic culture. the strain exhibited good acid tolerance in an artificial gastric solution as well as bile resistance in media containing 0.3% bile acids. the strain produced a heat-stable antimicrobial compound that was shown to be proteinaceous in nature and, therefore, referred to as a bacteriocin. the bacteriocin was active over a wide ph range and inhibited a number of gram-positive bacteria including listeria ivanovii and ... | 2000 | 11132841 |
| listeria species in raw and ready-to-eat foods from restaurants. | from september 1999 to march 2000, meat (pork, beef, and chicken), fish (salmon, hake, and sole), vegetable (lettuce and spinach), and spanish potato omelette samples obtained at restaurants were collected and tested for the occurrence of listeria spp. listeria monocytogenes was isolated from 3 (2.9%) out of 103 studied samples. other species isolated were listeria grayi (13.6%), listeria innocua (1.9%), listeria ivanovii (5.8%), listeria seeligeri (3.9%), and listeria welshimeri (1.9%). listeri ... | 2001 | 11307896 |
| listeria pathogenesis and molecular virulence determinants. | the gram-positive bacterium listeria monocytogenes is the causative agent of listeriosis, a highly fatal opportunistic foodborne infection. pregnant women, neonates, the elderly, and debilitated or immunocompromised patients in general are predominantly affected, although the disease can also develop in normal individuals. clinical manifestations of invasive listeriosis are usually severe and include abortion, sepsis, and meningoencephalitis. listeriosis can also manifest as a febrile gastroente ... | 2001 | 11432815 |
| identification and mutagenesis by allelic exchange of choe, encoding a cholesterol oxidase from the intracellular pathogen rhodococcus equi. | the virulence mechanisms of the facultative intracellular parasite rhodococcus equi remain largely unknown. among the candidate virulence factors of this pathogenic actinomycete is a secreted cholesterol oxidase, a putative membrane-damaging toxin. we identified and characterized the gene encoding this enzyme, the choe monocistron. its protein product, choe, is homologous to other secreted cholesterol oxidases identified in brevibacterium sterolicum and streptomyces spp. choe also exhibits signi ... | 2001 | 11466283 |
| comparison of the efficacy of different techniques, culture media, and sources of blood in determining the hemolytic activity of listeria spp.. | hemolytic activity is a fundamental criterion for the differentiation of listeria species; therefore, a simple and inexpensive procedure to clearly distinguish hemolytic strains from each other and from nonhemolytic strains would be of great aid. we compared the efficacy of several techniques, culture media, and types of blood in demonstrating the hemolysis of listeria spp. the hemolytic activities of listeria monocytogenes and listeria seeligeri were more easily detected with a red blood cell t ... | 2001 | 11547885 |
| chemical synthesis, molecular modeling, and antimicrobial activity of a novel bacteriocin, mmfii. | a new antimicrobial peptide, referred to as mmfii, was purified to homogeneity from lactic acid bacteria lactococcus lactis, which were isolated from tunisian dairy product. the complete amino acid sequence of the peptide has been established by amino acid analysis, edman sequencing, and mass spectrometry and verified by solid-phase chemical synthesis. mmfii is a single-chain 37-residue polypeptide containing a single intramolecular disulfide bond, i.e., tsygngvhcnkskcwidvseletykagtvsnpkdilw. it ... | 2001 | 11708769 |
| molecular cloning and expression of mn(2+)-dependent sphingomyelinase/hemolysin of an aquatic bacterium, pseudomonas sp. strain tk4. | we report here the molecular cloning and expression of a hemolytic sphingomyelinase from an aquatic bacterium, pseudomonas sp. strain tk4. the sphingomyelinase gene was found to consist of 1,548 nucleotides encoding 516 amino acid residues. the recombinant 57.7-kda enzyme hydrolyzed sphingomyelin but not phosphatidylcholine, phosphatidylserine, phosphatidylglycerol, phosphatidic acid, or phosphatidylethanolamine, indicating that the enzyme is a sphingomyelin-specific sphingomyelinase c. the hydr ... | 2002 | 11751833 |
| prevalence and contamination levels of listeria monocytogenes in smoked fish and pâté sold in spain. | from march to november 2000, 170 samples of smoked fish and 182 samples of pâté for sale in retail outlets and supermarkets in the nine provinces of castilla and león (spain) were analyzed for the prevalence of listeria monocytogenes and other listeria spp. l. monocytogenes was isolated from 38 (22.3%) of the 170 samples of smoked fish analyzed. twenty of these positive samples contained l. monocytogenes at >100 cfu/g. other listeria spp., such as listeria innocua (26 isolates), listeria grayi ( ... | 2001 | 11770642 |
| detection of pathogenic listeria spp. in zoo animal faeces: use of immunomagnetic separation and a chromogenic isolation medium. | faecal samples, collected from 200 healthy animals in antwerp zoo, were examined for the presence of pathogenic listeria spp. a two-stage standard isolation (iso) method was combined with immunomagnetic separation (ims). aloa agar, a chromogenic isolation medium, differentiating listeria spp. on the basis of beta-glucosidase and phosphatidylinositol-specific phospholipase c (piplc) activity, was compared with palcam agar. confirmation of the isolates was based on conventional biochemical tests a ... | 2003 | 12458161 |
| polymerase chain reaction detection of listeria monocytogenes on frankfurters using oligonucleotide primers targeting the genes encoding internalin ab. | a polymerase chain reaction (pcr) assay targeting the genes encoding internalin ab (inlab) was developed for detecting listeria monocytogenes in pure cell cultures and on artificially contaminated frankfurters. four sets of oligonucleotide primers were evaluated. the set targeting a 902-bp region of the inlab gene was the most specific. this pcr product was detected in 51 l. monocytogenes strains belonging to four different serogroups (1/2a, 1/2b, 1/2c, and 4b). in contrast, the pcr product was ... | 2003 | 12597483 |
| prevalence of listeria spp. in feces and carcasses at a lamb packing plant in brazil. | the objective of this work was to study the occurrence of listeria species in feces and on dressed and cooled carcasses of lambs at a packing plant in brazil. listeria spp. were recovered on oxford and palcam agars. the 35 fecal samples yielded listeria welshimeri (20%) and listeria innocua (8.6%). the 69 carcass samples yielded l. innocua (34.8%), listeria monocytogenes (4.3%), and listeria ivanovii (1.5%). more listeria spp. were recovered with two selective agars than with either agar alone. | 2003 | 12597497 |
| strong synergy between a eukaryotic antimicrobial peptide and bacteriocins from lactic acid bacteria. | the antimicrobial effect obtained upon combining the prokaryotic antimicrobial peptides (amps; more commonly referred to as bacteriocins) pediocin pa-1, sakacin p, and curvacin a (all produced by lactic acid bacteria [lab]) with the eukaryotic amp pleurocidin (from fish) has been investigated. the three lab amps alone were active against gram-positive listeria ivanovii bacteria at nanomolar concentrations, whereas they were inactive against gram-negative escherichia coli bacteria. pleurocidin al ... | 2003 | 12620872 |
| capacity of ivanolysin o to replace listeriolysin o in phagosomal escape and in vivo survival of listeria monocytogenes. | listeriolysin o (llo, hly-encoded) is a major virulence factor secreted by the pathogen listeria monocytogenes. the amino acid sequence of llo shows a high degree of similarity with that of ivanolysin o (ilo), the cytolysin secreted by the ruminant pathogen listeria ivanovii. here, it was tested whether ilo could functionally replace llo by expressing the gene encoding ilo under the control of the hly promoter, in an hly-deleted strain of l. monocytogenes. it is shown that ilo allows efficient p ... | 2003 | 12634330 |
| evaluation and interlaboratory validation of a selective agar for phosphatidylinositol-specific phospholipase c activity using a chromogenic substrate to detect listeria monocytogenes from foods. | phosphatidylinositol-specific phospholipase c (pi-plc) activity is a potential virulence factor and is exhibited only by the listeria species listeria monocytogenes and listeria ivanovii. a chromogenic substrate for the direct detection of pi-plc activity is available in a new medium (bcm l. monocytogenes plating agar). the use of a chromogenic substrate offers a mechanism with which to directly screen for l. monocytogenes and l. ivanovii other than the esculin used in oxford (oxf) and palcam (p ... | 2003 | 12636298 |
| bacteriocin-like substance (bls) production in aeromonas hydrophila water isolates. | 30 aeromonas hydrophila water isolates were tested for bacteriocin-like substance (bls) production using a target panel of closely related microorganisms and other gram-positive and gram-negative bacteria, including food-borne pathogens. a. hydrophila showed antibacterial activity against one or more indicator microorganisms, but the activity emerged only with non-phylogenetically related genera or species. in particular all a. hydrophila showed antibacterial activity against one or more of the ... | 2003 | 12644237 |
| characterization and clinical manifestations of arcanobacterium phocae infections in marine mammals stranded along the central california coast. | between 1994 and 2000, 141 arcanobacterium phocae isolates were recovered from marine mammals that stranded along the central california coast (usa). arcanobacterium phocae was cultured from tissue sites with abnormal discharge or evidence of inflammation in 66 california sea lions (zalophus californianus), 50 pacific harbor seals (phoca vitulina richardii), 19 northern elephant seals (mirounga angustirostris), five southern sea otters (enhydra lutris nereis), and one common dolphin (delphinus d ... | 2003 | 12685077 |
| differences in gamma interferon production induced by listeriolysin o and ivanolysin o result in different levels of protective immunity in mice infected with listeria monocytogenes and listeria ivanovii. | two pathogenic species in the genus listeria, listeria monocytogenes and listeria ivanovii, are characterized by the production of hemolysins belonging to cholesterol-dependent cytolysins, listeriolysin o (llo) and ivanolysin o (ilo), respectively. llo, produced by l. monocytogenes, is able to induce gamma interferon (ifn-gamma) production and contributes to the generation of th1-dependent protective immunity. on the other hand, nothing is known about the role of ilo, produced by l. ivanovii, in ... | 2003 | 12704115 |