Publications

TitleAbstractYear
Filter
PMID
Filter
amplification of plaque-forming cells in the spleen after intracloacal antigen stimulation in neonatal chicken.neonatal chickens were primed by multiple or a single injection with sheep red blood cells (srbc) into the cloacal lumen and then were challenged by intravenous injection with the same antigen. direct plaque-forming cells (pfc) in the spleen were markedly increased shortly after intracloacal priming. this enhancing effect was antigen specific and was abolished by surgical bursectomy 24 h after intracloacal priming. a similar effect was also found in mature adult chickens, although the degree of ...197991577
association between pre-transplant natural kill and graft-versus-host disease after stem-cell transplantation.natural killer activity against herpes simplex virus type 1 infected fibroblasts nk(hsv-1) was studied prospectively in patients undergoing allogenic bone-marrow or fetal-tissue stem-cell transplantation. thirteen patients showed evidence of engraftment and survived long enough to develop graft-versus-host disease (gvhd). of this group, all of the seven having normal nk(hsv-1) activity before transplantation acquired gvhd and the six having low nk(hsv-1) had no evidence of gvhd. these results we ...197991840
human lung tissue and anaphylaxis:cyclic nucleotide response and prostaglandin synthesis. 197991946
hemolytic streptococci in supramammary lymph nodes from healthy pigs from the peruvian jungle.hemolytic streptococci were isolated from 53 percent (18) supramammary lymph nodes from healthy adult pigs raised at the peruvian jungle. the isolates were identified as streptococcus zooepidemicus, streptococcus infrequens, streptococcus faecalis and groups p and s. the possible significance of the findings are discussed.1978101478
chemosynthetic, photosynthetic, and cyanobacterial ribulose bisphosphate carboxylase. 1978106835
the radiographic diagnosis of heart disease in the dog. 1975123974
spasticity: actions of selectivity activated group ii muscle spindle afferents on extensor motoneurons. 1975129880
[electron microscopic studies of epinephrine choroiditis in rabbits. 3. scanning electron microscopic observations of the retinal pigment epithelial cells in the early stage (author's transl)]. 19751239915
antimutagenicity and binding of lactic acid bacteria from a chinese cheese to mutagenic pyrolyzates.the microbiological characteristics of nai ge da, a traditional cheese in china, was investigated. the lactic acid bacteria species were identified as streptococcus cremoris, streptococcus lactis ssp. diacetylactis, streptococcus faecalis, and leuconostoc paramesenteroides, leuconostoc dextranicum, and leuconostoc mesenteroides. streptococcus cremoris, and leuconostoc paramesenteroides were the dominant strains. the antimutagenicities and binding of strains of s. cremoris and s. lactic ssp. diac ...19901980923
plasmid transformation by electroporation of leuconostoc paramesenteroides and its use in molecular cloning.in this report, we demonstrate the utility of electroporation as an efficient method for genetic transformation of leuconostoc paramesenteroides. we optimized several factors which determine the transformation frequency, resulting in transformation efficiencies of up to 4 x 10(3) transformants per micrograms of pnz12 dna, which contains the promiscuous lactococcus lactis psh71 replicon. slightly lower efficiencies were obtained with a deletion derivative of the broad-host-range plasmid pam beta ...19892504108
effect of early revascularization on the ischaemic rat brain.rat brains made regionally ischaemic by manipulation of the large vessels in the neck were revascularized up to 4 hours later. mortality rates, patterns of ink staining and the water content of the brains were studied. scanning and transmission electron microscopy was carried out. the results showed that whilst revascularization did not reperfuse areas of the brain that had been subjected to very low levels of perfusion, it did reperfuse other areas with higher perfusion and, in so doing, preven ...19852860582
effect of early revascularization on the ischaemic rat brain.rat brains made regionally ischaemic by manipulation of the large vessels in the neck were revascularized up to 4 hours later. mortality rates, patterns of ink staining and the water content of the brains were studied. scanning and transmission electron microscopy was carried out. the results showed that whilst revascularization did not reperfuse areas of the brain that had been subjected to very low levels of perfusion, it did reperfuse other areas with higher perfusion and, in so doing, preven ...19852860582
in vivo and in vitro studies of urinary concentrating ability in potassium-depleted rabbits.the factors responsible for the urinary concentrating defect associated with the potassium-depleted (kd) state are uncertain. the present studies were designed to, first, determine whether a urinary concentrating defect exists in potassium-depleted rabbits and, second, to use the technique of in vitro perfusion to evaluate directly the antidiuretic hormone (adh) responsiveness of cortical collecting tubules (cct) in this setting. feeding female new zealand white rabbits a potassium-deficient die ...19852993361
histologic evaluation of response to implantation of polyvinilidine plates in dogs and rats.the effect of implantation of polyvinilidine spinal plates was studied when placed on spinous processes of 11 mixed breed dogs and when placed within the thoracolumbar musculature of 12 male white rats. specimens were also obtained from soft tissues adjacent to polyvinilidine plates 2 to 3 months after clinical surgery to repair spinal subluxations in three dogs. a similar pattern of dense, organized fibrous tissue interspersed with focal congregations of lymphocytes, plasma cells, and multinucl ...19883067442
the inhibition by valproic acid of the mitochondrial oxidation of monocarboxylic and omega-hydroxymonocarboxylic acids: possible implications for the metabolism of gamma-aminobutyric acid.the interactions of 1-5 mm valproic acid with the hepatic fatty acid oxidation are here described. valproic acid was not substrate for hepatic peroxisomal fatty acid oxidation. its activation outside the mitochondrial matrix compartment was poor when compared to that of octanoic acid, a fatty acid containing the same number of carbones. valproic acid did not inhibit the fatty acyl-coa oxidase nor the cyanide-insensitive acyl-coa oxidation. valproic acid inhibited the mitochondrial oxidations of ...19873117781
comparison of live, attenuated h1n1 and h3n2 cold-adapted and avian-human influenza a reassortant viruses and inactivated virus vaccine in adults.the infectivity, immunogenicity, and efficacy of live, attenuated influenza a/texas/1/85 (h1n1) and a/bethesda/1/85 (h3n2) avian-human (ah) and cold-adapted (ca) reassortant vaccines were compared in 252 seronegative adult volunteers. the immunogenicity and efficacy of the h1n1 reassortant vaccine were also compared with those of the trivalent inactivated virus vaccine. each reassortant vaccine was satisfactorily attenuated. the 50% human infectious dose was 10(4.9) for ca h1n1, 10(5.4) for ah h ...19883198936
prolonged expression of differentiated phenotype by chondrocytes cultured at low density on a composite substrate of collagen and agarose that restricts cell spreading.the dedifferentiation of chondrocytes in culture is frequently associated with transition from a rounded to a spread morphology. a number of culture methods which prevent cell spreading have been described; however, all have disadvantages that limit their widespread use. in this paper we describe a new technique which allows prolonged cultivation of attached chondrocytes at low density while inhibiting spreading: the cells are grown on a composite substrate of agarose and collagen. by varying th ...19883209004
nitrogenase of klebsiella pneumoniae. kinetic studies on the fe protein involving reduction by sodium dithionite, the binding of mgadp and a conformation change that alters the reactivity of the 4fe-4s centre.the kinetics of reduction of indigocarmine-dye-oxidized fe protein of nitrogenase from klebsiella pneumoniae (kp2ox) by sodium dithionite in the presence and absence of mgadp were studied by stopped-flow spectrophotometry at 23 degrees c and at ph 7.4. highly co-operative binding of 2mgadp (composite k greater than 4 x 10(10) m-2) to kp2ox induced a rapid conformation change which caused the redox-active 4fe-4s centre to be reduced by so2-.(formed by the predissociation of dithionite ion) with k ...19873318808
actions of prostaglandins e2 and f2 alpha on release of 14c-labelled mucins from rat submandibular salivary acini in vitro.mucin secretion was studied in vitro using well-characterized preparations of isolated acini. pge2 significantly (p less than 0.05) increased release of [14c]-glucosamine labelled mucins at the highest concentration tested (10(-5) m), but was ineffective at lower doses (10(-9)-10(-6) m). pgf2 alpha had no effect on mucin secretion over this concentration range. pge2 (10(-9)-10(-5) m) did not modify isoproterenol stimulated mucin secretion. the cyclooxygenase inhibitor indomethacin (10(-7)-10(-5) ...19873482153
the effects of vasectomy on the testis.the increased use of vasectomy for population control has led to a large number of animal studies on the morphologic, physiologic, and immunologic responses to this procedure. the extent, nature, and timing of morphologic alterations in the testis showed marked species variations and ranged from autoimmune orchitis to an absence of detectable changes. physiologic studies indicated, contrary to expectation, that the hydrostatic pressure was elevated only in the distal part of the epididymis and ...19854058509
the localization of alkaline phosphatase activity in the rat small intestinal epithelium after fat and protein feeding. 19744218700
[effect of some radiosensitizing agents on the dynamics of 24 na and 42 k in the dog]. 19724341099
studies on the lysosomes of l132 cells infected with either rhinovirus type 2 or poliovirus type 1. 19744362408
immunopathogenicity and oncogenicity of murine leukemia viruses. i. induction of immunologic disease and lymphoma in (balb-c times nzb)f1 mice by scripps leukemia virus.this report clearly demonstrates that a systemic lupus erythematosus (sle)-like syndrome and lymphoma can be induced in immunologically normal (balb/c x nzb)f(1) mice by infection of neonates with a murine leukemia virus (mulv) (scripps leukemia virus [slv] 60a) isolated from nzb lymphoblasts. slv 60a was titered in vitro (xc test) and administered to newborn and adult (balb/c x nzb)f(1) mice over six log(10) dilutions. propagation of mulv in the newborn recipients was indicated by greatly eleva ...19744372290
the role of the olfactory route on infection of the respiratory tract with venezuelan equine encephalomyelitis virus in normal and operated macaca rhesus monkeys. ii. results of histological examination. 19734405397
biologic parameters of adenovirus transformation. 19734571262
biologic parameters of adenovirus transformation. 19734571262
isoenzymic differences between culture forms of trypanosoma rangeli, t. cruzi, and t. lewisi. 19744608715
oral biology in japan 1973-1974. 2. dental histology. 19744620494
some critical remarks and suggestions about antilymphocyte serum. 19724628101
studies on chemotaxis. vi. specific chemotaxis in rabbit polymorphonuclear leucocytes and mononuclear cells. 19674860339
glucose production and utilization in the newborn puppy. 19704911571
studies on liver regeneration. ii. effects of phenobarbital on the onset and pattern of rat liver regeneration following partial hepatectomy. 19714947050
the growth factor and amino acid requirements of species of the genus leuconostoc, including leuconostoc paramesenteroides (sp.nov.) and leuconostoc oenos. 19676052634
bacteriocins of leuconostocs isolated from meat.several bacteriocin-producing leuconostoc strains have been isolated from meat and identified as leuconostoc gelidum ual 187, leuconostoc paramesenteroides-la7a, leuconostoc carnosum-ta11a and leuconostoc carnosum-la54a. all strains produce bacteriocins that are active against listeria monocytogenes and other lactic acid bacteria of concern in meat spoilage. all of the bacteriocins studied are heat stable in acidic environments and are inactivated by a range of proteolytic enzymes but not by cat ...19947703031
bacteriocins produced by leuconostoc species.leuconostoc spp. are lactic acid bacteria that are commonly associated with foods and that are used as starter bacteria in some dairy fermentations. lactic acid bacteria are inhibitory to other bacteria because of ph, organic acids, hydrogen peroxide, and other chemicals produced during their growth, including bacteriocins. bacteriocin production by leuconostoc spp. was first observed in the 1950s, but only since 1984, when antagonistic activity of leuconostoc spp. was reported, have more extens ...19947814741
characterisation of lactic acid bacteria isolated from naturally fermented greek dry salami.a total of 348 lactic acid bacteria isolated from five batches of naturally fermented dry salami at various stages of ripening were characterised. the majority of the strains were assigned to two main phylogenetic groups of species: (i) the psychrotrophic, formerly called atypical, meat streptobacteria (169 strains) and (ii) a new genus weissella (120), which was recently proposed (collins et al., 1993) to include leuconostoc paramesenteroides and some other closely related species. meat strepto ...19947848780
taxonomic studies on some leuconostoc-like organisms from fermented sausages: description of a new genus weissella for the leuconostoc paramesenteroides group of species.taxonomic studies were performed on some unknown leuconostoc-like organisms from fermented greek sausage. comparative 16s rrna sequence analysis showed the unidentified organisms represent a new line within the leuconostoc paramesenteroides group of species. on the basis of the results of this and earlier phylogenetic investigations, it is proposed that leuconostoc paramesenteroides and related species be reclassified in a new genus weissella. in addition a new species, weissella hellenica, is p ...19938294308
mesenterocin 52, a bacteriocin produced by leuconostoc mesenteroides ssp. mesenteroides fr 52.one hundred and sixty-five isolates of leuconostoc spp. were tested for bacteriocin production. only one strain, leuc. mesenteroides ssp. mesenteroides fr 52, isolated from a raw milk, produced a bacteriocin which was named mesenterocin 52. this bacteriocin inhibited other leuconostoc strains and several strains of enterococcus and listeria spp. no activity was found against lactococci and lactobacilli. the antibacterial spectrum differed from that of previously described leuconostoc bacteriocin ...19938486542
microflora of boza, a traditional fermented turkish beverage.boza, a turkish traditional beverage made by yeast and lactic acid fermentation of cooked maize, wheat and rice flours was prepared and the microbial characteristics were investigated. during the course of fermentation from 0 to 24 h, populations of lactic acid bacteria and yeast raised from 7.6 x 10(6) and 2.25 x 10(5) after inoculation to 4.6 x 10(8) and 8.1 x 10(6), respectively; ph dropped from 6.1 to 3.5; total titratable acidity by means of lactic acid increased from 0.02 to 0.27 mmol/g; a ...19979105937
characterization of strains of leuconostoc mesenteroides by analysis of soluble whole-cell protein pattern, dna fingerprinting and restriction of ribosomal dna.of 215 leuconostocs isolated from field grass, natural whey cultures and water-buffalo milk, 178 were identified as leuconostoc mesenteroides ssp. mesenteroides while 37 strains could not be identified. biochemical characterization allowed seven groups to be defined. representative strains of each group and different habitat and nine reference strains were selected for further analyses. protein profiles appeared suitable for species discrimination, but did not differentiate between the three sub ...19979172399
influence of lactobacillus spp. from an inoculant and of weissella and leuconostoc spp. from forage crops on silage fermentationlactobacillus spp. from an inoculant and weissella and leuconostoc spp. from forage crops were characterized, and their influence on silage fermentation was studied. forty-two lactic acid-producing cocci were obtained from forage crops and grasses. all isolates were gram-positive, catalase-negative cocci that produced gas from glucose, and produced more than 90% of their lactate in the d-isomer form. these isolates were divided into groups a and b by sugar fermentation patterns. two representati ...19989687461
usefulness of rapid gc analysis of cellular fatty acids for distinguishing weissella viridescens, weissella paramesenteroides, weissella hellenica and some non-identifiable, arginine-negative weissella strains of meat origin.in an attempt to differentiate between weissella viridescens, w. paramesenteroides, w. hellenica and some atypical arginine-negative weissella isolates from meats, their cellular fatty acid composition was determined by a rapid gc method. results showed that w. viridescens synthesized eicosenoic (n-c20:1) acid, while the other two species did not. meanwhile, unlike w. paramesenteroides, w. hellenica lacked cyclopropane fatty acids with 19 carbon atoms, i.e. dihydrosterculic or lactobacillic acid ...19989704112
cloning and molecular characterization of the citrate utilization citmcdefgrp cluster of leuconostoc paramesenteroides.the citmcdefgrp cluster from leuconostoc paramesenteroides involved in citrate utilization was cloned and its nucleotide sequence determined. homology of the inferred gene products with characterized enzymes reveals that citp encodes the citrate permease p, citc the citrate ligase and citdef the subunits of the citrate lyase of leuconostoc. moreover, it suggests that citm encodes a leuconostoc malic enzyme. analysis of citrate consumption by and citrate lyase activity of lc. paramesenteroides j1 ...199910339813
transcriptional control of the citrate-inducible citmcdefgrp operon, encoding genes involved in citrate fermentation in leuconostoc paramesenteroides.in this study we describe the expression pattern of the leuconostoc paramesenteroides citmcdefgrp operon in response to the addition of citrate to the growth medium. an 8.8-kb polycistronic transcript, which includes the citmcdefgrp genes, was identified; its synthesis was dramatically induced upon addition of citrate to the growth medium. we also found that expression of the cit operon is subjected to posttranscriptional regulation, since processing sites included in four complex secondary stru ...200010869065
molecular diversity of leuconostoc mesenteroides and leuconostoc citreum isolated from traditional french cheeses as revealed by rapd fingerprinting, 16s rdna sequencing and 16s rdna fragment amplification.for a long time, the identification of the leuconostoc species has been limited by a lack of accurate biochemical and physiological tests. here, we use a combination of rapd, 16s rdna sequencing, and 16s rdna fragment amplification with specific primers to classify different leuconostocs at the species and strain level. we analysed the molecular diversity of a collection of 221 strains mainly isolated from traditional french cheeses. the majority of the strains were classified as leuconostoc mes ...200010930080
assessment of acid production by various human oral micro-organisms when palatinose or leucrose is utilized.one promising way of reducing caries is by using sucrose substitutes in food, e.g., palatinose or leucrose. previous experiments addressing cariogenic potential of sucrose substitutes have focused mainly on streptococcus mutans. however, given the many other micro-organisms in the oral cavity, this study compared the acid production of 100 bacterial strains representing 44 different species, by batch fermentation in a test tube containing, as a sole carbohydrate source, glucose, sucrose, palatin ...200111269732
variations in the membrane fatty acid composition of resistant or susceptible leuconostoc or weissella strains in the presence or absence of mesenterocin 52a and mesenterocin 52b produced by leuconostoc mesenteroides subsp. mesenteroides fr52.mesenterocins 52a (mes52a) and 52b (mes52b) are antimicrobial peptides produced by leuconostoc mesenteroides subsp. mesenteroides fr 52. mes52a is a class iia bacteriocin of lactic acid bacteria with a broad spectrum of activity. mes52b is an atypical class ii bacteriocin with a narrow spectrum of activity. four leuconostoc and weissella wild-type strains were selected for their susceptibility or insensitivity to these mesenterocins. four strains resistant to mes52a or mes52b were generated from ...200212039749
phylogenetic, amino acid content and indel analyses of the beta subunit of dna-dependent rna polymerase of gram-positive and gram-negative bacteria.in this study, we have sequenced the rpob gene, encoding the beta subunit of dna-dependent rna polymerase, from a selection of gram-positive and gram-negative bacteria. the presence of insertions and deletions (indels) in the beta subunit separate the gram-positive and gram-negative bacteria from each other and support the division of the gram-positive organisms into two clades based on dna g+c content. phylogenetic and amino acid content analyses further separate the clostridia from bacilli, le ...200212361249
effect of proteolytic starter cultures as leavening agents of pizza dough.lactic acid bacteria (lab) and yeasts were selected on the basis of in vitro proteolytic activity against wheat gluten protein and then assayed as leavening agents for pizza dough. trials were carried out to compare a proteolytic starter (prt(+)), consisting of lactobacillus sakei t56, weissella paramesenteroides a51 and candida krusei g271, and a non-proteolytic starter (prt(-)), consisting of lb. sakei t58, w. paramesenteroides a58 and saccharomyces cerevisiae t22. the proteolytic activity of ...200312810294
physical and genetic map of the weissella paramesenteroides dsmz 20288t chromosome and characterization of different rrn operons by its analysis.the weissella paramesenteroides dsmz 20288t chromosome was analysed by pulsed-field gel electrophoresis, enabling the construction of a physical and genetic map. a total of 21 recognition sites of the restriction enzymes asci, i-ceui, noti and sfii were mapped on the chromosome, which was found to be circular with an estimated size of 2026 kb. this is believed to constitute the first study into the genomic organization of a strain of this genus, addressing the localization of important chromosom ...200415583160
citi, a transcription factor involved in regulation of citrate metabolism in lactic acid bacteria.a large variety of lactic acid bacteria (lab) can utilize citrate under fermentative conditions. although much information concerning the metabolic pathways leading to citrate utilization by lab has been gathered, the mechanisms regulating these pathways are obscure. in weissella paramesenteroides (formerly called leuconostoc paramesenteroides), transcription of the citmdefcgrp citrate operon and the upstream divergent gene citi is induced by the presence of citrate in the medium. although genet ...200516030208
transformation of ginsenosides rb1 and re from panax ginseng by food microorganisms.ginsenosides rb1 and re, respectively belonging to the major protopanaxadiol and protopanaxatriol ginsenosides, were transformed using cell-free extracts from food microorganisms. rb1 was transformed into compound k via rd and f2 by bifidobacterium sp. int57, bif. sp. sj32, aspergillus niger and a. usamii. lactobacillus delbrueckii, and leuconostoc paramesenteroides transformed rb1 into rh2 via rd and f2. bifidobacterium sp. sh5 transformed rb1 into f2 via rd. re was transformed into rh1 via rg2 ...200516086257
diversity and technological properties of predominant lactic acid bacteria from fermented cassava used for the preparation of gari, a traditional african food.traditional fermentation of cassava is dominated by a lactic acid bacteria (lab) population. fermentation is important for improving product flavour and aroma as well as safety, especially by reduction of its toxic cyanogenic glucosides. the production of gari from cassava in benin typically occurs on a household or small industrial scale, and consequently suffers from inconsistent product quality and may not always be safe for consumption. therefore, the diversity of lab from a typical cassava ...200516104351
production of an amylase-sensitive bacteriocin by an atypical leuconostoc paramesenteroides strain.an atypical leuconostoc paramesenteroides strain isolated from retail lamb produced a bacteriocin, leuconocin s, that was inactivated by alpha-amylase, trypsin, alpha-chymotrypsin, protease, and proteinase k but not by lipase or heat treatment at 60 degrees c for 30 min. supernatants from culture broths produced two glycoprotein bands on sodium dodecyl sulfate-polyacrylamide gels; these had molecular weights of 2,000 and 10,000 and activity against lactobacillus sake atcc 15521. the crude bacter ...199216348619
characterisation and biochemical properties of predominant lactic acid bacteria from fermenting cassava for selection as starter cultures.a total of 375 lactic acid bacteria were isolated from fermenting cassava in south africa, benin, kenya and germany, and were characterised by phenotypic and genotypic tests. these could be divided into five main groups comprising strains of facultatively heterofermentative rods, obligately heterofermentative rods, heterofermentative cocci, homofermentative cocci and obligately homofermentative rods, in decreasing order of predominance. most of the facultatively heterofermentative rods were iden ...200717188771
impact of polyunsaturated fatty acid degradation on survival and acidification activity of freeze-dried weissella paramesenteroides lc11 during storage.the impact of polyunsaturated fatty acid (pufa) degradation on the survival and acidification activity of freeze-dried weissella paramesenteroides lc11 was investigated over 90-days storage at 4 degrees c or 20 degrees c in vacuum-sealed aluminium foil or glass tubes with two water activities (a(w)=0.11 or 0.23). colony counts, acidification activity (% lactic acid/g), linoleic/palmitic (18:2/16:0) or linolenic/palmitic (18:3/16:0) ratio by gas chromatography and 18:2 or 18:3 oxylipins by revers ...200818461316
identification of yeast and bacteria involved in the mezcal fermentation of agave salmiana.aims: to identify the yeast and bacteria present in the mezcal fermentation from agave salmiana. methods and results: the restriction and sequence analysis of the amplified region, between 18s and 28s rdna and 16s rdna genes, were used for the identification of yeast and bacteria, respectively. eleven different micro-organisms were identified in the mezcal fermentation. three of them were the following yeast: clavispora lusitaniae, pichia fermentans and kluyveromyces marxianus. the bacteria foun ...200818489025
screening of surface properties and antagonistic substances production by lactic acid bacteria isolated from the mammary gland of healthy and mastitic cows.bovine mastitis (bm) is a costly disease in dairy cattle production. the prevention and treatment of mastitis is performed by applying antimicrobial products that negatively affect milk quality. in the last years, the use of probiotic microorganisms to prevent infections in humans and animals has being aggressively studied. samples from teat canal and milk (foremilk and stripping) were taken from healthy and mastitic mammary quarters. a screening of the surface properties and antagonistic substa ...200919041199
isolation of lactobacilli from sow milk and evaluation of their probiotic potential.sow milk protects the piglet against infectious diseases through a variety of mechanisms. in this study, the presence of potentially probiotic lactic acid bacteria in this biological fluid was investigated. milk samples were obtained from 8 sows and a total of 19 rod-shaped isolates were selected for identification and assessment of their probiotic potential. rapd profiling revealed the existence of 8 different genetic profiles among them. one representative of each profile was selected for furt ...200919640313
diversity of lactic acid bacteria in suan-tsai and fu-tsai, traditional fermented mustard products of taiwan.fu-tsai and suan-tsai are spontaneously fermented mustard products traditionally prepared by the hakka tribe of taiwan. we chose 5 different processing stages of these products for analysis of the microbial community of lactic acid bacteria (lab) by 16s rrna gene sequencing. from 500 lab isolates we identified 119 representative strains belonging to 5 genera and 18 species, including enterococcus (1 species), lactobacillus (11 species), leuconostoc (3 species), pediococcus (1 species), and weiss ...200919700215
effect of protective compounds on the survival, electrolyte leakage, and lipid degradation of freeze-dried weissella paramesenteroides lc11 during storage.the effect of cryoprotectants (maltodextrin+glycerol) and cryoprotectants+antioxidant [ascorbic acid and/or butylated hydroxytoluene (bht)] mixtures on the survival, electrolyte leakage, and lipid degradation of freeze-dried weissella paramesenteroides lc11 during storage was investigated and compared with that of the control (cells without additives) over a 90-day storage period at 4 or 20 degrees in glass tubes with water activity (a(w)) of 0.23. the survival, electrolyte leakage, and lipid de ...200919734719
probiotic table olives: microbial populations adhering on olive surface in fermentation sets inoculated with the probiotic strain lactobacillus paracasei impc2.1 in an industrial plant.this study reports the dynamics of microbial populations adhering on the surface of debittered green olives cv. bella di cerignola in fermentation sets inoculated with the probiotic strain lactobacillus paracasei impc2.1 in different brining conditions (4% and 8% (w/v) nacl) at room temperature and 4 degrees c. the probiotic strain successfully colonized the olive surface dominating the natural lab population and decreasing the ph of brines to <or=5.0 after 30 days until the end of fermentation. ...201020226556
development and analysis of microbial characteristics of an acidulocomposting system for the treatment of garbage and cattle manure.an acidulocomposting system for the treatment of cattle manure with little emission of ammonia gas was developed, and the structure of its microbial community was investigated by denaturing gradient gel electrophoresis (dgge) and clone library construction. an acidulocomposting apparatus (bc20, 20 l) was operated for 79 days to treat 2 kg (wet wt) of garbage per 1 or 2 days. on day 80 of operation, the substrate was changed from garbage to cattle manure (1 kg of beef cattle manure was added to t ...201020547374
characterization of lactic acid bacteria from musts and wines of three consecutive vintages of ribeira sacra.this study was designed to isolate and characterize the lactic acid microbiota of the musts and wines of a young denomination of origin area, ribeira sacra in north-west spain.201121204877
purification, amino acid sequence and characterization of the class iia bacteriocin weissellin a, produced by weissella paramesenteroides dx.weissella paramesenteroides dx has been shown to produce a 4450-da class iia bacteriocin, weissellin a, composed of 43 amino acids with the sequence knygngvycnkhkcsvdwatfsaniannsvamagltggnagn. the bacteriocin shares 68% similarity with leucocin c from leuconostoc mesenteroides. computational analyses predict that the bacteriocin is a hydrophobic molecule with a beta-sheet type conformation. weissellin a exhibited various levels of activity against all gram-positive bacteria tested, but was not a ...201121511463
Microbial diversity in the midguts of field and lab-reared populations of the European corn borer Ostrinia nubilalis.BACKGROUND: Insects are associated with microorganisms that contribute to the digestion and processing of nutrients. The European Corn Borer (ECB) is a moth present world-wide, causing severe economical damage as a pest on corn and other crops. In the present work, we give a detailed view of the complexity of the microorganisms forming the ECB midgut microbiota with the objective of comparing the biodiversity of the midgut-associated microbiota and explore their potential as a source of genes an ...201121738787
effects of dissolved oxygen and ph levels on weissellin a production by weissella paramesenteroides dx in fermentation.experiments carried out with the dissolved oxygen tension (dot) maintained during fermentation at 0, 10, 50, 70 and 100% showed a direct effect of the dissolved oxygen levels on weissellin a production with no correlative increase on biomass. an estimate of the yield of weissellin a per gram biomass revealed the 50% dot level as the optimum for increased yields. the effect of ph was studied in experiments carried out without ph control, with ph initially set at 6.0, 5.0 and 4.5 and with ph contr ...201222274910
a potent probiotic strain from cheddar cheese.a lactic acid bacteria leuconostoc paramesenteroides was isolated and characterized from cheddar cheese and was adapted to grow at low ph (2.0) and high bile salt concentration (2%) by sequential sub-culturing so that it can survive the extreme environmental condition of gut. cell hydrophobicity assay shows the maximum adherence of the culture to toluene (46.11%). adhesion ability was confirmed by in vitro assay using rat intestinal epithelial layer. the culture has an antimicrobial activity aga ...201122753999
identification and characterization of lactic acid bacteria isolated from mixed pasture of timothy and orchardgrass, and its badly preserved silage.in order to understand the relationship between lactic acid bacteria (lab) species and silage fermentation, a total of 65 lab strains isolated from mixed pasture of timothy (phleum pratense l.) and orchardgrass (dactylis glomerata l.), and its badly preserved silages were subjected to phenotypic and genetic analysis. according to these analyses, the isolates were divided into 13 groups, including enterococcus gallinarum, lactobacillus acidipiscis, l. coryniformis subsp. coryniformis, l. corynifo ...201122515692
[literature documentation--information system]. 20164805592
gut hormones in fetal distress. 199991067
brotherly lumps. familial occurrence of chemodectoma. 20144295142
some effects of maintaining pulmonary nitrogenation during anaesthesia. 20154621295
treatment of lead poisoning at yale-new haven hospital 1970. 20164998354
the biological section of an m.sc. course in forensic science. 20144133952
third party reimbursement for nursing services in new york state: a survey. 20123457107
[orthopedic maxillofacial surgery]. 20133787589
[treatment of ankylosing spondylitis]. 20154626640
communicable disease report october to december 1989. from the phls communicable disease surveillance centre. 20082223199
a comparison of the prevalence of hepatitis-b surface antigen (hbsag) positivity among hospital and non-hospital personnel. 20134093406
results of a conservative treatment combining induction (neoadjuvant) and consolidation chemotherapy, hormonotherapy, and external and interstitial irradiation in 98 patients with locally advanced breast cancer (iiia-iiib).ninety-eight patients with locally advanced breast cancer (stage iiia-iiib) were entered into a pilot study combining intensive induction (neoadjuvant) chemotherapy (vtmfap) with or without hormonochemotherapy, external and interstitial radiotherapy, and consolidation chemotherapy with or without hormonochemotherapy. tumor regression over 50% was observed in 91% patients after chemotherapy, and complete clinical remission occurred in 100% patients after irradiation. the rate of local relapse is ...20113129176
mr of intramedullary spinal cysticercosis. 20113128089
computer automated evaluation and prediction of the iball index of carcinogenicity of polycyclic aromatic hydrocarbons. 20143991677
behavioural reactions to triazolam. 199991745
profile of orthopaedic surgical practice at a non-teaching naval regional medical center. 199999703
isolation and characterization of bleomycin-resistant clones of cho cells. 200094572
[histochemical changes in the morphologic structure of tissues in women with inflammatory diseases of the internal genital organs]. 2002124045
[studies on the specificity of the antistreptolysin-reaction (author's transl)]. 2002126540
[experience with the balneological treatment of rheumatoid arthritis at a republic hospital]. 2003154770
[study of k42 metabolism by the method of whole body radiometry in patients with myopathies]. 20051196025
transplantation behavior of a.th and a.tl t-cell lymphomas in congenic resistant and hybrid strains.seven spontaneously arising t-cell lymphomas originating in a.th or a.tl mice, which are congenic for the immune response gene (i) chromosomal segment were described. when transplanted into partner strains which were incompatible at the i region, the tumors were rapidly rejected. rejection was proposed to be due to the presence of antigens controlled by i-region genes.20051079852
[leukocyte and atherosclerosis]. 20071947989
the cerebral ischemic penumbra. 20082446732
childhood obsessive compulsive disorder: a two-year prospective follow-up of a community sample.a 2-year prospective follow-up of a community-based sample of adolescents previously diagnosed as having obsessive compulsive disorder (ocd) or "obsessive compulsive spectrum" disorder and a control sample was completed by clinicians experienced with ocd but blind to prior diagnosis. an initial diagnosis of ocd or "other psychiatric disorder with oc features" was most likely to predict a diagnosis of ocd at follow-up. subclinical ocd at baseline did not strongly predict continuing psychopatholog ...20092768147
the connecticut hospice, inc. and aids: a profile. 20113180805
[various matters concerning the improvement of therapeutic tactics in epilepsy].the author has analyzed the results of the therapy of 200 epileptic patients and outlined the main causes of its low effectiveness: a high rate of the development and dissemination of foci of epileptic activity, a limited array of drugs for controlling non convulsive paroxysms of a complex structure, a decrease in the tolerance of large doses of drugs and intercurrent diseases. the author have developed principles of a therapeutic strategy based on the prophylactic treatment in relation to the s ...20113092518
high technology and medicine: selected spin-offs of the space program. 20123387028
the role of the transit peptide in the routing of precursors toward different chloroplast compartments.the role of the transit peptide in the routing of imported proteins inside the chloroplast was investigated with chimeric proteins in which the transit peptides for the nuclear-encoded ferredoxin and plastocyanin precursors were exchanged. import and localization experiments with a reconstituted chloroplast system show that the ferredoxin transit peptide directs mature plastocyanin away from its correct location, the thylakoid lumen, to the stroma. with the plastocyanin transit peptide-mature fe ...20133731274
peripheral vestibular disturbances in the electronystagmogram. 20144190135
Displaying items 1 - 100 of 146