| pr-1, a novel antifungal protein from pumpkin rinds. | a novel antifungal protein, m(r) = ca. 40 kda, was isolated from pumpkin rind and designated pr-1. when purified by anion exchange chromatography and hplc, it inhibited growth of several fungi including botrytis cinerea, fusarium oxysporum, fusarium solani and rhizoctonia solani, as well as the yeast, candida albicans, at 10-20 microm. it did not inhibit growth of escherichia coli or staphylococcus aureus even at 200 microm. laser scanning microscopy of fungal cells exposed to rhodamine-labeled ... | 2010 | 19760117 |
| the role of short-range cys171-cys178 disulfide bond in maintaining cutinase active site integrity: a molecular dynamics simulation. | understanding structural determinants in enzyme active site integrity can provide a good knowledge to design efficient novel catalytic machineries. fusarium solani pisi cutinase with classic triad ser-his-asp is a promising enzyme to scrutinize these structural determinants. we performed two md simulations: one, with the native structure, and the other with the broken cys171-cys178 disulfide bond. this disulfide bond stabilizes a turn in active site on which catalytic asp175 is located. function ... | 2009 | 19781526 |
| design of eudragit rl 100 nanoparticles by nanoprecipitation method for ocular drug delivery. | the objective of the current study was to prepare positively charged amphotericin-b-loaded nanoparticles providing a controlled release formulation. the particles were prepared by solvent displacement or nanoprecipitation method. the non-biodegradable positively charged polymer eudragit rl 100 was used to prepare the different formulations with varying ratios of drug and polymer. the formulations were evaluated in terms of particle size, zeta potential, and differential scanning calorimetry meas ... | 2010 | 19800990 |
| genetic diversity in the fungus fusarium solani f.sp. cucurbitae race 1, the casual agent of root and crown rot of cucurbits in iran, using molecular markers. | fusarium solani f.sp. cucurbitae race 1 is a pathogen on cucurbit plants. in this study genetic diversity among 26 isolates of fusarium solani f.sp. cucurbitae race 1 was studied using restriction fragment length polymorphism (rflp) of its (interal transcribed spacer) regions and random amplified polymorphic dnas (rapd) markers. outcome of digestion with six restriction enzymes including ecor i, rsa i, bme 181, msp i, hae iii and hind iii, together with the patterns of restriction fragment lengt ... | 2009 | 19803117 |
| antifungal mechanism of a novel antifungal protein from pumpkin rinds against various fungal pathogens. | a novel antifungal protein (pr-2) was identified from pumpkin rinds using water-soluble extraction, ultrafiltration, cation exchange chromatography, and reverse-phase high-performance liquid chromatography. matrix-assisted laser desorption/ionization time-of-flight mass spectrometry indicated that the protein had a molecular mass of 14865.57 da. automated edman degradation showed that the n-terminal sequence of pr-2 was qgigvgdndgkrgkr-. the pr-2 protein strongly inhibited in vitro growth of bot ... | 2009 | 19807165 |
| structural and functional studies of aspergillus oryzae cutinase: enhanced thermostability and hydrolytic activity of synthetic ester and polyester degradation. | cutinases are responsible for hydrolysis of the protective cutin lipid polyester matrix in plants and thus have been exploited for hydrolysis of small molecule esters and polyesters. here we explore the reactivity, stability, and structure of aspergillus oryzae cutinase and compare it to the well-studied enzyme from fusarium solani. two critical differences are highlighted in the crystallographic analysis of the a. oryzae structure: (i) an additional disulfide bond and (ii) a topologically favor ... | 2009 | 19810726 |
| steady state and time resolved fluorescence quenching and chemical modification studies of a lectin from endophytic fungus fusarium solani. | the solute quenching studies of a lectin from endophytic fungus fusarium solani were carried out using different quenchers such as acrylamide, succinimide, potassium iodide and cesium chloride. the lectin showed emission maximum at 348 nm indicating relative exposure of tryptophan. the quenchable fraction of the fluorophore was 100% with acrylamide, whereas it was only 50% with succinimide. the ionic quenchers iodide and cesium showed opposite effects at different ph. in the case of cesium, rais ... | 2010 | 19823920 |
| endophytic bacteria from ocimum sanctum and their yield enhancing capabilities. | endophytes are beneficial microbes that reside intercellularly inside the plants. interaction of endophytes with the host plants and their function within their host are important to address ecological relevance of endophyte. four endophytic bacteria os-9, os-10, os-11, and os-12 were isolated from healthy leaves of ocimum sanctum. these isolated microbes were screened in dual culture against various phytopathogenic fungi viz. rhizoctonia solani, sclerotium rolfsii, fusarium solani, alternaria s ... | 2010 | 19826860 |
| parthenium management by cultural filtrates of phytopathogenic fungi. | in the present study, herbicidal activity of culture filtrates of nine phytopathogenic fungi, namely, alternaria alternata (fr.) keissl., drechslera australiensis (bugnicourt) subramanian & jain, drechslera hawaiiensis (curtis and cooke) shoemaker, drechslera biseptata (saccardo & roumeguere) richardson & fraser., drechslera rostrata (drechsler) ricardson & fraser, fusarium oxysporum (massey) synd. & hans., fusarium solani (martius) saccardo., monilia stophila (montagne) and cladosporium sp. (gr ... | 2009 | 19844827 |
| endophytic fungal strains of fusarium solani, from apodytes dimidiata e. mey. ex arn (icacinaceae) produce camptothecin, 10-hydroxycamptothecin and 9-methoxycamptothecin. | camptothecin and 10-hydroxycamptothecin are two important precursors for the synthesis of the clinically useful anticancer drugs, topotecan and irinotecan. in recent years, efforts have been made to identify novel plant and endophytic fungal sources of camptothecin and 10-hydroxycamptothecin. in this study we have isolated endophytic fungi strains from apodytes dimidiata (icacinaceae), a medium sized tree from the western ghats, india. the fungi were identified as fusarium solani using both its ... | 2010 | 19863979 |
| a murine model of contact lens-associated fusarium keratitis. | fusarium solani and f. oxysporum were the causative organisms of the 2005/2006 outbreak of contact lens-associated fungal keratitis in the united states. the present study was an investigation of the ability of f. oxysporum grown as a biofilm on silicone hydrogel contact lenses to induce keratitis. | 2010 | 19875664 |
| biodegradation of low-density polyethylene (ldpe) by isolated fungi in solid waste medium. | in this study, biodegradation of low-density polyethylene (ldpe) by isolated landfill-source fungi was evaluated in a controlled solid waste medium. the fungi, including aspergillus fumigatus, aspergillus terreus and fusarium solani, were isolated from samples taken from an aerobic aged municipal landfill in tehran. these fungi could degrade ldpe via the formation of a biofilm in a submerged medium. in the sterilized solid waste medium, lpde films were buried for 100 days in a 1-l flask containi ... | 2010 | 19919893 |
| pyrene degradation and copper and zinc uptake by fusarium solani and hypocrea lixii isolated from petrol station soil. | this study aimed to isolate and identify potential polycyclic aromatic hydrocarbon (pah)-degrading and/or metal-tolerant fungi from pah-contaminated and metal-contaminated soils. | 2010 | 19922595 |
| [successful treatment of resistant fusarium solani keratitis with liposomal amphotericin b]. | the prognosis for fusarium keratitis is poor. effective drugs to treat this infection are therefore needed. | 2009 | 19942316 |
| transesterification of oil mixtures catalyzed by microencapsulated cutinase in reversed micelles. | recombinant cutinase from fusarium solani pisi was used to catalyze the transesterification reaction between a mixture of triglycerides (oils) and methanol in reversed micelles of bis(2-ethylhexyl) sodium sulfosuccinate (aot) in isooctane for the purposes of producing biodiesel. the use of a bi-phase lipase-catalyzed system brings advantages in terms of catalyst re-use and the control of water activity in the medium and around the enzyme micro-environment. small-scale batch studies were performe ... | 2010 | 19943181 |
| an outbreak of early-onset endophthalmitis caused by fusarium species following cataract surgery. | this study aimed to report an outbreak of early-onset endophthalmitis caused by fusarium species following cataract surgery. | 2009 | 19958115 |
| identifying sequences potentially related to resistance response of piper tuberculatum to fusarium solani f. sp. piperis by suppression subtractive hybridization. | piper tuberculatum is an exotic piper from the amazon region that shows resistance to infection by fusarium solani f. sp. piperis, causal agent of fusarium disease in black pepper (piper nigrum l.). in this work we aimed to study the interaction between p. tuberculatum and f. solani f. sp. piperis at a molecular level, using suppression subtractive hybridization to identify genes potentially related to fusarium disease resistance. comparative sequence analysis confirmed that clones isolated here ... | 2009 | 20001904 |
| silver enhances the in vitro antifungal activity of the saponin, cay-1. | summary the fungicidal properties of purified cay-1, dissolved silver ion and ethylenediamine tetraacetic acid (edta) separately were studied in vitro as were the abilities of silver and edta to enhance cay-1 fungicidal properties. non-germinated and germinating conidia of aspergillus flavus, aspergillus fumigatus, aspergillus niger, fusarium verticillioides (fusarium moniliforme), fusarium oxysporum and fusarium solani were incubated separately with cay-1 (0-24.8 mug ml(-1)), silver (0-111.1 mu ... | 2009 | 20002309 |
| concurrent acanthamoeba and fusarium keratitis with silicone hydrogel contact lens use. | purpose:: to report a case of simultaneous acanthamoeba and fusarium keratitis associated with no-rob multipurpose contact lens solution and silicone hydrogel contact lens use. method:: observational case report results:: a 39-ycar-old woman was referred for worsening of a presumed bacterial conical ulcer in the setting of silicone hydrogel lens wear with occasional overnight wear, no-rub multipurpose contact lens solution use, and combined topical antibiotic/corticosteroid treatment. initial co ... | 2009 | 20023585 |
| a dark strain in the fusarium solani species complex isolated from primary subcutaneous sporotrichioid lesions associated with traumatic inoculation via a rose bush thorn. | fusarium species are hyaline hyphomycetes widely distributed in nature and documented agents of both superficial and systemic infections in humans. in this paper, we report a darkly-pigmented and initially non-sporulating isolate in the fusarium solani species complex (fssc) causing a post-traumatic sporotrichoid infection in an otherwise healthy, male patient. sequencing of multiple loci showed that the isolate represented an otherwise unknown lineage, possibly corresponding to a separate speci ... | 2010 | 20055744 |
| onychomycosis caused by fusarium solani in a woman with diabetes. | a case of untreated fusarial onychomycosis leading to serious consequences is reported. fusarium solani is a widespread fungus and an occasional human pathogen. it usually invades rapidly in immunocompromised hosts, and often results in a poor outcome despite treatment. we report a woman with diabetes mellitus who had untreated fusarial infection of the nails, which developed into subcutaneous fusariosis, superinfected by bacteria, and then evolved into osteomyelitis that subsequently resulted i ... | 2009 | 20055843 |
| the microbiology of lascaux cave. | lascaux cave (montignac, france) contains paintings from the upper paleolithic period. shortly after its discovery in 1940, the cave was seriously disturbed by major destructive interventions. in 1963, the cave was closed due to algal growth on the walls. in 2001, the ceiling, walls and sediments were colonized by the fungus fusarium solani. later, black stains, probably of fungal origin, appeared on the walls. biocide treatments, including quaternary ammonium derivatives, were extensively appli ... | 2010 | 20056706 |
| multi-enzyme inhibition assay for the detection of insecticidal organophosphates and carbamates by high-performance thin-layer chromatography applied to determine enzyme inhibition factors and residues in juice and water samples. | esterase inhibition assays provide an effect-directed tool of rapid screening for inhibitors in environmental and food samples. according to a multi-enzyme microtiter-plate assay, rabbit liver esterase (rle), bacillus subtilis esterase (bs2), and cutinase from fusarium solani pisi (cut) were used for the detection of 21 organophosphorus and carbamate pesticides by high-performance thin-layer chromatography-enzyme inhibition assays (hptlc-ei). staining was performed with fast blue salt b coupling ... | 2010 | 20060788 |
| efficacy of posaconazole as treatment and prophylaxis against fusarium solani. | invasive fusariosis is a highly aggressive fungal infection associated with high mortality in heavily immunocompromised patients. although posaconazole is efficacious as salvage therapy against infections caused by fusarium species, concerns remain regarding this agent in the setting of reduced potency. to evaluate the efficacy of posaconazole as treatment or prophylaxis against invasive fusariosis caused by fusarium solani, we utilized a neutropenic murine model of disseminated disease. icr mic ... | 2010 | 20065054 |
| [culture-filtrate producing condition and biological activity of fusarium solani]. | to study the culture-filtrate producing condition of fusarium solani isolated from astragalus root and explore the mechanism astragalus root rot disease caused by, in order to find theoretical support for screening resistant germ plasma via mycotoxin. | 2009 | 20069894 |
| improvement of sec-dependent secretion of a heterologous model protein in bacillus subtilis by saturation mutagenesis of the n-domain of the amye signal peptide. | due to the lack of an outer membrane, gram-positive bacteria (e.g., bacillus species) are considered as promising host organisms for the secretory production of biotechnologically relevant heterologous proteins. however, the yields of the desired target proteins were often reported to be disappointingly low. here, we used saturation mutagenesis of the positively charged n-domain (positions 2-7) of the signal peptide of the bacillus subtilis alpha-amylase (amye) as a novel approach for the improv ... | 2010 | 20077115 |
| two cutinase-like proteins secreted by mycobacterium tuberculosis show very different lipolytic activities reflecting their physiological function. | cutinases are extracellular enzymes that are able to degrade cutin, a polyester protecting plant leaves and many kinds of lipids. although cutinases are mainly found in phytopathogenic fungi or bacteria, 7 genes related to the cutinase family have been predicted in the genome of mycobacterium tuberculosis. these genes may encode proteins that are involved in the complex lipid metabolism of the bacterium. here, we report on the biochemical characterization of two secreted proteins of m. tuberculo ... | 2010 | 20103719 |
| molecular phylogenetic diversity of dermatologic and other human pathogenic fusarial isolates from hospitals in northern and central italy. | fifty-eight fusaria isolated from 50 italian patients between 2004 and 2007 were subject to multilocus dna sequence typing to characterize the spectrum of species and circulating sequence types (sts) associated with dermatological infections, especially onychomycoses and paronychia, and other fusarioses in northern and central italy. sequence typing revealed that the isolates were nearly evenly divided among the fusarium solani species complex (fssc; n = 18), the f. oxysporum species complex (fo ... | 2010 | 20107100 |
| a case of primary localized cutaneous infection due to fusarium oxysporum. | fusarium is a ubiquitous hyalohyphomycete isolated from food, widespread in the environment (plants, soil) and present at all latitudes. fusarium oxysporum and fusarium solani are the most frequent pathogenic species, followed by f. moniliforme and f. chlamydosporum. infections due to this mold may be disseminated or localized. localized forms include cutaneous and subcutaneous infection, onychomycosis, endophtalmitis, otitis, sinusitis, arthritis, osteomyelitis, and brain abscess. disseminated ... | 2010 | 20177971 |
| endophytic fungi diversity of aquatic/riparian plants and their antifungal activity in vitro. | two hundred and fourteen endophytic fungi were isolated from 500 segments of aquatic/riparian plants ottelia acuminata, myriophyllum verticillatum, equisetum arvense, cardamine multijuga, and impatiens chinensis. they were identified to 31 taxa in which cladosporium, fusarium, and geotrichum were the dominant genera. among all isolates, 169 (79%) were anamorphic fungi, 1 (0.5%) was an teleomorphic ascomycete and 44 (21%) were sterile mycelia. there were significant differences in the colonizatio ... | 2010 | 20221722 |
| [characterization of a chitosanase from fusarium solani and its expression in an industrial strain of saccharomyces cerevisiae]. | to investigate the biochemical characteristics of the chitosanase from fusarium solani, and its application in chitooligosaccharides production, and express the chitosanase gene (csn) in a saccharomyces cerevisiae industrial strain. | 2009 | 20222446 |
| natural occurrence of the fusarium solani on tityus stigmurus (thorell, 1876) (scorpiones: buthidae). | members of the fusarium solani species complex are agents of human mycoses, also affecting plants and other animals. nevertheless, this fungus has not been reported on scorpions. ten specimens of tityus stigmurus collected in the field and showing their surface covered by white mycelia were used to assess fungus presence in the animal after its death. identification of the fungi was based upon the cultural and morphological characteristics. the fungus was isolated from chelicerae and intersegmen ... | 2010 | 20231972 |
| synthesis and antileishmanial and antimicrobial activities of some 2,3-disubstituted 3h-quinazolin-4-ones. | a series of 2,3-disubstituted 3h-quinazolin-4-ones was synthesized. antimicrobial activities of the synthesized compounds were investigated against gram (+ve) and gram (-ve) bacteria, including b. subtilis, s. aureus, s. flexneri, p. aeruginosa, and s. typhi, and six fungi, namely trichophyton longifusus, candida albicans, aspergillus flavus, microsporum canis, fusarium solani, and candida glabrata using the broth microdilution method. compounds 9, 11, and 12 showed significant activities agains ... | 2010 | 20235747 |
| on the structure and possible functions of a pigment of fusarium solani d2 purple. | | 1947 | 20270776 |
| acidified nitrite enhances hydrogen peroxide disinfection of acanthamoeba, bacteria and fungi. | in the human innate immune system, stimulated phagocytes release reactive nitrogen intermediates that can react with superoxide to form the powerful oxidant peroxynitrite and other less abundant species. in this study, the efficacy of hydrogen peroxide (h2o2) and acidified nitrite (nano2) alone and in combination was compared against a variety of bacteria, fungi and protozoa. | 2010 | 20335189 |
| metal based biologically active compounds: design, synthesis, and antibacterial/antifungal/cytotoxic properties of triazole-derived schiff bases and their oxovanadium(iv) complexes. | a new series of oxovanadium(iv) complexes have been designed and synthesized with a new class of triazole schiff bases derived from the reaction of 3,5-diamino-1,2,4-triazole with 2-hydroxy-1-naphthaldehyde, pyrrole-2-carboxaldehyde, pyridine-2-carboxaldehyde and acetyl pyridine-2-carboxaldehyde, respectively. physical (magnetic susceptibility, molar conductance), spectral (ir, (1)h nmr, (13)c nmr, mass and electronic) and analytical data have established the structures of these synthesized schi ... | 2010 | 20338672 |
| [mycotic keratitis in an eye care hospital in mexico city]. | some of the most common precipitating events for keratomycoses (fungal keratitis), include surgical trauma (after cornea transplantation), the use of contaminated contact lenses or alterations in lacrimal secretions. diagnosis and treatment (to avoid loss of vision) for these type of infections are challenging. | 2010 | 20346302 |
| other fungi causing onychomycosis. | nondermatophyte onychomycosis account for 2% to 12% of all nail fungal infections and can be caused by a wide range of fungi, mainly scopulariopsis brevicaulis, aspergillus versicolor, a. flavus, a. niger, a. fumigatus, fusarium solani, f. oxysporum and scytalidium spp. among the predisposing factors are footwear, hyperhidrosis, local trauma, peripheral circulatory disease, and immunosuppression. these nondermatophyte fungi lack the keratinolytic capacity of dermatophytes, but they still can inf ... | 2010 | 20347658 |
| mycotic keratitis in india: a five-year retrospective study. | mycotic keratitis is a fungal infection of the cornea. this infection is difficult to treat and it can lead to severe visual impairment or blindness. it is worldwide in distribution, but is more common in the tropics and subtropical regions. trauma is the major predisposing factor, followed by ocular and systemic defects, prior application of corticosteroids, and prolonged use of antibiotic eye-drops. the objective of this study was to determine causative agents and to identify the predisposing ... | 2010 | 20351459 |
| knock down of chitosanase expression in phytopathogenic fungus fusarium solani and its effect on pathogenicity. | chitosanases are lytic enzymes involved in the degradation of chitosan, a component of fungal cell walls. the phytopathogenic fungus fusarium solani produces an extracellular chitosanase, csn1, the role of which in the physiology and virulence of the fungus remains to be expounded. here, we studied the expression of the csn1 gene through gene silencing and examined its effect on fungal pathogenicity. a vector construct encoding a hairpin rna (hprna) of csn1 was constructed and introduced into th ... | 2010 | 20419375 |
| direct site-directed photocoupling of proteins onto surfaces coated with beta-cyclodextrins. | a method called dock'n'flash was developed to offer site-specific capture and direct uva-induced photocoupling of recombinant proteins. the method involves the tagging of recombinant proteins with photoreactive p-benzoyl-l-phenylalanine (pbpa) by genetic engineering. the photoreactive pbpa tag is used for affinity capture of the recombinant protein by beta-cyclodextrin (beta-cd), which provides hydrogen atoms to be abstracted in the photocoupling process. to exemplify the method, a recombinant, ... | 2010 | 20441154 |
| do multipurpose contact lens disinfecting solutions work effectively against non-fda/iso recommended strains of bacteria and fungi? | recent outbreaks of microbial keratitis have increased concerns about the efficacy of multipurpose solutions (mps) against 'real-world' organisms. this study determined, in accordance with fda/iso standard methods, the effects of five mps against clinical isolates and type strains of bacteria, and isolates of fungi from subjects' ocular structures; and of three mps against environmental fungal isolates. | 2010 | 20444107 |
| the genomic organization of plant pathogenicity in fusarium species. | comparative genomics is a powerful tool to infer the molecular basis of fungal pathogenicity and its evolution by identifying differences in gene content and genomic organization between fungi with different hosts or modes of infection. through comparative analysis, pathogenicity-related chromosomes have been identified in fusarium oxysporum and fusarium solani that contain genes for host-specific virulence. lateral transfer of pathogenicity chromosomes, inferred from genomic data, now has been ... | 2010 | 20471307 |
| miniemulsion as efficient system for enzymatic synthesis of acid alkyl esters. | the aim of this work is to devise an efficient enzymatic process for the production of linear alkyl esters in aqueous miniemulsion systems. the esterification reactions of linear alcohols and carboxylic acids were performed with three different enzymes, commercial amano lipase ps from pseudomonas cepacia, lipase type vii from candida rugosa, and lyophilized fusarium solani pisi cutinase expressed in saccharomyces cerevisiae su50. the miniemulsion system shows a high potential for the synthesis o ... | 2010 | 20503297 |
| fungal outbreak in a show cave. | castañar de ibor cave (spain) was discovered in 1967 and declared a natural monument in 1997. in 2003 the cave was opened to public visits. despite of extensive control, on 26 august 2008 the cave walls and sediments appeared colonized by long, white fungal mycelia. this event was the result of an accidental input of detritus on the afternoon of 24 august 2008. we report here a fungal outbreak initiated by mucor circinelloides and fusarium solani and the methods used to control it. | 2010 | 20553941 |
| analysis of pea hmg-i/y expression suggests a role in defence gene regulation. | summary hmg-i/y proteins are characterized by the presence of at-hook motifs, dna binding domains that recognize at-rich tracts of dna. by facilitating protein:protein and protein:dna interactions in the vicinity of these at-rich binding sites, hmg-i/y positively or negatively regulates gene expression. several pea defence gene promoters have at-rich tracts of dna that are potential targets for modulation via hmg-i/y. in this study, a comparison of the expression of a pea defence gene (drr206) m ... | 2003 | 20569385 |
| oxidation of elemental sulfur by fusarium solani strain thif01 harboring endobacterium bradyrhizobium sp. | nineteen fungal strains having an ability to oxidize elemental sulfur in mineral salts medium were isolated from deteriorated sandstones of angkor monuments. these fungi formed clearing zone on agar medium supplemented with powder sulfur due to the dissolution of sulfur. representative of the isolates, strain thif01, was identified as fusarium solani on the basis of morphological characteristics and phylogenetic analyses. pcr amplification targeting 16s rrna gene and analyses of full 16s rrna ge ... | 2010 | 20571793 |
| characterization of a 20 kda dnase elicitor from fusarium solani f. sp. phaseoli and its expression at the onset of induced resistance in pisum sativum. | summary dnase released from fusarium solani f. sp. phaseoli (fsph dnase) has previously been reported to induce pathogenesis-related (pr) genes, phytoalexin accumulation and disease resistance against subsequent challenge with the true pea pathogen, fusarium solani f. sp. pisi (fspi). this report is a further analysis of dnase production with probes specific for both the gene and protein. n-terminal analysis of the approximately 20 kda fsph dnase protein facilitated both the development of anti- ... | 2001 | 20573002 |
| novel short antibacterial and antifungal peptides with low cytotoxicity: efficacy and action mechanisms. | short antimicrobial peptides with nine and eleven residues were developed against several clinically important bacterial and fungal pathogens (specifically escherichia coli, pseudomonas aeruginosa, staphylococcus aureus, candida albicans, and fusarium solani). twelve analogues of previously reported peptides bp76 (kklfkkilkfl) and pac-525 (kwrrwvrwi) were designed, synthesized, and tested for their antimicrobial activities. two of our eleven amino acid peptides, p11-5 (gklfkkilkil) and p11-6 (kk ... | 2010 | 20603106 |
| development of a new mlst scheme for differentiation of fusarium solani species complex (fssc) isolates. | fungi belonging to the fusarium solani species complex (fssc) are well known plant pathogens. in addition to being the causative agent of some superficial infections, fssc has recently emerged as a group of common opportunistic moulds, mainly in patients with haematological malignancies. molecular typing methods are essential in order to better understand the epidemiology of such opportunistic agents with the final goal of preventing contamination. a three-locus typing scheme has thus been devel ... | 2010 | 20624428 |
| antimicrobial activity of simulated solar disinfection against bacterial, fungal, and protozoan pathogens and its enhancement by riboflavin. | riboflavin significantly enhanced the efficacy of simulated solar disinfection (sodis) at 150 watts per square meter (w m(-2)) against a variety of microorganisms, including escherichia coli, fusarium solani, candida albicans, and acanthamoeba polyphaga trophozoites (>3 to 4 log(10) after 2 to 6 h; p < 0.001). with a. polyphaga cysts, the kill (3.5 log(10) after 6 h) was obtained only in the presence of riboflavin and 250 w m(-2) irradiance. | 2010 | 20639371 |
| agar block smear preparation: a novel method of slide preparation for preservation of native fungal structures for microscopic examination and long-term storage. | we describe a novel method of fungal slide preparation named "agar block smear preparation." a total of 510 agar block smears of 25 fungal strains obtained from culture collections, 90 qc fungal strains, and 82 clinical fungal strains from our clinical microbiology laboratory, which included a total of 137 species of yeasts, molds, and thermal dimorphic fungi, were prepared and examined. in contrast to adhesive tape preparation, agar block smears preserved the native fungal structures, such as i ... | 2010 | 20660221 |
| biodegradation of anthracene and benz[a]anthracene by two fusarium solani strains isolated from mangrove sediments. | an investigation was undertaken on the biodegradation of two kinds of polycyclic aromatic hydrocarbons (pahs), anthracene (ant) and benz[a]anthracene (baa), by fungi isolated from pah-contaminated mangrove sediments environment in ma wan, hong kong. ant (50mg l(-1)) and baa (20mg l(-1)), respectively, were added to mineral salt medium initially for screening of pah-degrading fungi, and finally two fungal species capable of using ant or baa as the sole carbon source were isolated and identified a ... | 2010 | 20691587 |
| purification and characterization of an extracellular laccase from the anthracene-degrading fungus fusarium solani mas2. | an extracellular laccase was purified from the culture medium of the non-white rot, anthracene-degrading fungal strain fusarium solani mas2. both native page and sds-page revealed one single band corresponding to a molecular weight of about 72 kda. treatment with endoglycosidase h reduced the molecular weight by 12%. the purified laccase maintained stable at ph 3-11 and up to 50 degrees c. the highest activity was detected at ph 3.0 and at 70 degrees c. the enzyme retained 46.2-97.2% of it activ ... | 2010 | 20716485 |
| biocidal efficacy of silver-impregnated contact lens storage cases in vitro. | silver-impregnated contact lens (cl) storage cases are designed to reduce microbial contamination during use, but there are limited data on their effectiveness. this study evaluated early antimicrobial activity of silver-impregnated cl cases and silver-release characteristics in vitro. | 2011 | 20720221 |
| a novel class of peptide pheromone precursors in ascomycetous fungi. | recently, sexual development in the heterothallic ascomycete trichoderma reesei (anamorph of hypocrea jecorina) has been achieved and thus initiated attempts to elucidate regulation and determinants of this process. while the α-type pheromone of this fungus fits the consensus known from other fungi, the assumed a-type peptide pheromone precursor shows remarkably unusual characteristics: it comprises three copies of the motif (li)gc(ts)vm thus constituting a caax domain at the c-terminus and two ... | 2010 | 20735770 |
| fusarium keratitis 3 weeks after healed corneal cross-linking. | to report a case of fusarium solani keratitis after corneal cross-linking (cxl) treatment. | 2010 | 20795586 |
| effect of biofumigation with manure amendments and repeated biosolarization on fusarium densities in pepper crops. | in the region of murcia (southeast spain), sweet pepper has been grown as a monoculture in greenhouses for many years. until 2005, when it was banned, soils were disinfested with methyl bromide (mb) to control pathogens and to prevent soil fatigue effects. the genus fusarium plays an important role in the microbiological component associated with yield decline in pepper monocultures. in the present study, soils were treated with manure amendments, alone (biofumigation, b) or in combination with ... | 2011 | 20820866 |
| solar disinfection of fungal spores in water aided by low concentrations of hydrogen peroxide. | our previous contribution showed that fusarium solani spores are inactivated by low amounts of hydrogen peroxide (lower than 50 mg l(-1)) together with solar irradiation in bottles. the purpose of the current study was to evaluate the effectiveness of solar h(2)o(2)/uv-vis in distilled water and simulated municipal wastewater treatment plant effluent (se) contaminated with chlamydospores of fusarium equiseti in a 60 l solar cpc photo-reactor under solar irradiation. this study showed that f. equ ... | 2011 | 20859602 |
| fusarium solani is responsible for mass mortalities in nests of loggerhead sea turtle, caretta caretta, in boavista, cape verde. | the fungus fusarium solani (mart.) saccardo (1881) was found to be the cause of infections in the eggs of the sea turtle species caretta caretta in boavista island, cape verde. egg shells with early and severe symptoms of infection, as well as diseased embryos were sampled from infected nests. twenty-five isolates with similar morphological characteristics were obtained. their its rrna gene sequences were similar to the genbank sequences corresponding to f. solani and their maximum identity rang ... | 2010 | 20875054 |
| fusarium solani invader of the eggs of the insectpanstrongylus geniculatus in a vivarium. | a strain offusarium solani sensu snyder & hansen invaded the eggs of the insectpanstrongylus geniculatus in a vivarium. none of the invaded eggs hatched. to establish experimentally the pathogenicity of thisfusarium species against the eggs ofp. geniculatus, the fungus and the eggs were incubated together under different relative humidities and temperatures. at 64% relative humidity and 26 °c, the fungus grew well colonizing and penetrating all of the chorions.three embryos died and were also co ... | 1996 | 20882454 |
| direct enzymatic acylation of cellulose pretreated in bmimcl ionic liquid. | cellulose esters are an important class of functional biopolymers with great interest in the chemical industry. in this work the enzymatic acylation of avicel cellulose with vinyl propionate, vinyl laurate and vinyl stearate, has been performed successfully in a solvent free reaction system. at first cellulose was putted into the ionic liquid bmimcl (1-n-butyl-3-methylimidazolium chloride) in order to facilitate the unwrap of the structure of the polysaccharide molecule and make it accessible to ... | 2010 | 20888759 |
| successful treatment of fusarium solani ecthyma gangrenosum in a patient affected by leukocyte adhesion deficiency type 1 with granulocytes transfusions. | ecthyma gangrenosum (eg) manifests as a skin lesion affecting patients suffering extreme neutropenia and is commonly associated with pseudomonas aeruginosa in immunocompromised patients. leukocyte adhesion deficiency i (lad i) which count among primary immunodeficiency syndromes of the innate immunity, is an autosomal recessive disorder characterized in its severe phenotype by a complete defect in cd18 expression on neutrophils, delayed cord separation, chronic skin ulcers mainly due to recurren ... | 2010 | 20929531 |
| dermatitis in captive wyoming toads (bufo baxteri) associated with fusarium spp. | from may 2007 to june 2008, 30 of 49 wyoming toads (bufo baxteri) kept at omaha's henry doorly zoo (nebraska, usa) died showing clinical signs of ventral erythema, inappetance, lethargy, and delayed righting reflex. treatment with antifungals and antibiotics was unsuccessful in all cases. histopathologic analyses revealed dermatitis as the primary problem in 20 of 21 toads in which skin was examined. fungal dermatitis was present in 17 toads, with hyphae approximately 1-3 μm in diameter, and par ... | 2010 | 20966269 |
| transgenically expressed rice germin-like protein1 in tobacco causes hyper-accumulation of h2o2 and reinforcement of the cell wall components. | our recent report documented that the rice germin-like protein1 (osglp1), being a cell wall-associated protein involves in disease resistance in rice and possesses superoxide dismutase (sod) activity as recognized by heterologous expression in tobacco. in the present study, the transgenic tobacco plants were analyzed further to decipher the detailed physiological and biochemical functions of the osglp1 and its associated sod activity. the transgenic tobacco lines expressing sod-active osglp1 sho ... | 2010 | 20971065 |
| action of supernatants from combined growth of fusarium solani and pseudomonas aeruginosa against the tubercle bacillus. | | 1946 | 21026122 |
| enzymes for the biofunctionalization of poly(ethylene terephthalate). | the functionalization of synthetic polymers such as poly(ethylene terephthalate) to improve their hydrophilicity can be achieved biocatalytically using hydrolytic enzymes. a number of cutinases, lipases, and esterases active on polyethylene terephthalate have been identified and characterized. enzymes from fusarium solani, thermomyces insolens, t. lanuginosus, aspergillus oryzae, pseudomonas mendocina, and thermobifida fusca have been studied in detail. thermostable biocatalysts hydrolyzing poly ... | 2010 | 21076908 |
| elimination of hydrophobic volatile organic compounds in fungal biofilters: reducing start-up time using different carbon sources. | fungal biofilters have been recently studied as an alternative to the bacterial systems for the elimination of hydrophobic volatile organic compounds (voc). fungi foster reduced transport limitation of hydrophobic vocs due to their hydrophobic surface and extended gas exchange area associated to the hyphal growth. nevertheless, one of their principal drawbacks is their slow growth, which is critical in the start-up of fungal biofilters. this work compares the use of different carbon sources (gly ... | 2010 | 21077141 |
| [expression of integrin during the course of adhesion between fungi and corneal epithelial cells]. | to investigate the expression of integrin during the course of adhesion between fungi and corneal epithelial cells. | 2010 | 21092564 |
| identification of fusarium species in formalin-fixed and paraffin-embedded sections by in situ hybridization using peptide nucleic acid probes. | fusarium has recently emerged as an opportunistic pathogen of humans, but the histological differentiation of fusarium from aspergillus and scedosporium is particularly difficult because these fungi may induce similar clinical features and exhibit filamentous development in host tissues. thus, there is a need to establish rapid and reliable methods that are applicable to pathological diagnoses. the aim of this study was to evaluate and establish in situ hybridization (ish) using peptide nucleic ... | 2010 | 21106796 |
| sudden-death syndrome of soybean is caused by two morphologically and phylogenetically distinct species within the fusarium solani species complex--f. virguliforme in north america and f. tucumaniae in south america. | soybean sudden-death syndrome has become a serious constraint to commercial production of this crop in north and south america during the past decade. to assess whether the primary etiological agent is panmictic in both hemispheres, morphological and molecular phylogenetic analyses were conducted on strains selected to represent the known pathogenic and genetic diversity of this pathogen. maximum-parsimony analysis of dna sequences from the nuclear ribosomal intergenic spacer region and the sing ... | 2003 | 21148975 |
| a polycationic antimicrobial and biocompatible hydrogel with microbe membrane suctioning ability. | despite advanced sterilization and aseptic techniques, infections associated with medical implants have not been eradicated. most present coatings cannot simultaneously fulfil the requirements of antibacterial and antifungal activity as well as biocompatibility and reusability. here, we report an antimicrobial hydrogel based on dimethyldecylammonium chitosan (with high quaternization)-graft-poly(ethylene glycol) methacrylate (dmdc-q-g-em) and poly(ethylene glycol) diacrylate, which has excellent ... | 2010 | 21151166 |
| changing indications for lamellar keratoplasty in shandong, 1993 - 2008. | with the advancement of microsurgical techniques, lamellar keratoplasty (lk) has been more valued and performed to treat corneal blindness. this study aimed to evaluate the indications and changing trends for lk during the past 16 years in shandong eye institute, an eye center in china. | 2010 | 21163128 |
| antifungal activity of pvd1 defensin involves plasma membrane permeabilization, inhibition of medium acidification, and induction of ros in fungi cells. | in recent years, studies have demonstrated the function of many antimicrobial peptides against an extensive number of microorganisms that have been isolated from different plant species and that have been used as models for the study of various cellular processes linked to these peptides' activities. recently, a new defensin from phaseolus vulgaris (l.) seeds, named pvd(1,) was isolated and characterized. pvd(1) was purified through anion exchange and phase-reverse chromatography. pvd(1)'s antif ... | 2010 | 21170711 |
| [fusarium solani infection in a patient after allogeneic hemotopoietic stem cell transplantation: case report and literature review]. | to study fusarium solani infection as a complication in patients after allogeneic hemotopoietic stem cell transplantation and to discuss the diagnosis and appropriate therapy. | 2010 | 21176501 |
| in vivo confocal microscopy of equine fungal keratitis. | to describe in vivo corneal confocal microscopy of horses with fungal keratitis and correlate findings with clinical, histopathological, and microbiological evaluations of clinical cases and an ex vivo experimental equine fungal keratitis model. | 2011 | 21199274 |
| a photopolymerized antimicrobial hydrogel coating derived from epsilon-poly-l-lysine. | hydrogels made from epsilon-poly-l-lysine-graft-methacrylamide (epl-ma) have been found to have impressive wide spectrum antimicrobial activity against both bacteria (specifically escherichia coli, pseudomonas aeruginosa, serratia marcescens and staphylococcus aureus) and fungi (specifically candida albicans and fusarium solani). the epl-ma hydrogel also possesses in vitro biocompatibility and epl-ma solution is relatively non-hemolytic: the concentration needed for onset of human red blood cell ... | 2011 | 21257199 |
| pathogenic spectrum of fungal keratitis and specific identification of fusarium solani. | to investigate the predominant causative pathogens and epidemiologic features of fungal keratitis and establish a rapid, specific molecular method to detect fungal keratitis caused by fusarium solani. | 2011 | 21273551 |
| performance of a cutinase membrane reactor for the production of biodiesel in organic media. | the enzymatic transesterification of oils with an alcohol, using recombinant cutinase of fusarium solani pisi microencapsulated in sodium bis(2-ethylhexyl) sulfosuccinate (aot)/isooctane reversed micelles, was performed in a membrane bioreactor (mbr). a tubular ceramic membrane with a nominal molecular weight cut off of 15,000 da was used to retain the enzyme, and characterized in terms of rejection coefficients of the reaction components by transmission experiments. the performance of the mbr i ... | 2011 | 21290382 |
| evaluations of shorter exposures of contact lens cleaning solutions against fusarium oxysporum species complex and fusarium solani species complex to simulate inappropriate usage. | an outbreak of fusarium keratitis in contact lens users resulted in withdrawal of renu with moistureloc solution, although the exact cause of the outbreak remains enigmatic. we evaluated current and discontinued multipurpose cleaning solutions (mpss; moistureloc, equate, multiplus, and optifree express) against plankton- and biofilm-derived cells of fusarium oxysporum species complex (fosc) and f. solani species complex (fssc). the methods included a traditional assay based on cfu counts and a n ... | 2011 | 21300826 |
| endophthalmitis as primary clinical manifestation of fatal fusariosis in an allogeneic stem cell recipient. | the occurrence of infections due to previously rare opportunistic pathogens is increasing despite the use of novel treatment strategies for immunocompromised patients. here, we report the case of a patient presenting with fever, muscle pain, and bilateral endophthalmitis after allogeneic hematopoietic stem cell transplantation. fusarium solani was isolated from peripheral blood samples and identified as the cause of gradual bilateral vision loss, despite appropriate antifungal prophylaxis, and t ... | 2011 | 21324055 |
| simultaneous detection and identification of aspergillus and mucorales species in tissues collected from patients with fungal rhinosinusitis. | rapid detection and differentiation of aspergillus and mucorales species in fungal rhinosinusitis diagnosis are desirable, since the clinical management and prognosis associated with the two taxa are fundamentally different. we describe an assay based on a combination of broad-range pcr amplification and reverse line blot hybridization (pcr/rlb) to detect and differentiate the pathogens causing fungal rhinosinusitis, which include five aspergillus species (a. fumigatus, a. flavus, a. niger, a. t ... | 2011 | 21325541 |
| osmotin purified from the latex of calotropis procera: biochemical characterization, biological activity and role in plant defense. | a protein, similar to osmotin- and thaumatin-like proteins, was purified from calotropis procera (ait.) r.br latex. the isolation procedure required two cation exchange chromatography steps on 50mm na-acetate buffer (ph 5.0) cm-sepharose fast flow and 25 mm na-phosphate buffer (ph 6.0) resource-s, respectively. the protein purity was confirmed by an unique n-terminal sequence [atftirnncpytiwaaavpgggrrlnsggtwtinvapgta]. the osmotin (cposm) appeared as a single band (20,100 da) in sodium dodecyl s ... | 2011 | 21334906 |
| glyceollin, a soybean phytoalexin with medicinal properties. | this review covers the biosynthesis of glyceollin and its biological activities including antiproliferative/antitumor action (toward b16 melanoma cells, lncap prostate cancer cells, and bg-1 ovarian cancer cells), anti-estrogenic action (through estrogen receptors a- and ß-), antibacterial action (toward erwinia carotovora, escherichia coli, bradyrhizobium japonicum, sinorhizobium fredii ), antinematode activity, and antifungal activity (toward fusarium solani, phakospora pachyrhizi, diaporthe p ... | 2011 | 21336922 |
| [clinical and mycological evaluation of onychomycosis among brazilian hiv/aids patients]. | onychomycosis is common in immunocompromised patients, but emerging species have been verified, thereby modifying the epidemiological profile of this mycosis. thus, the aim of this study was to evaluate clinical and mycological profile of onychomycosis among hiv/aids patients. | 2011 | 21340406 |
| effect of artificial reconstitution of the interaction between the plant camptotheca acuminata and the fungal endophyte fusarium solani on camptothecin biosynthesis. | fungal endophytes inhabit healthy tissues of all terrestrial plant taxa studied and occasionally produce host-specific compounds. we recently isolated an endophytic fungus, fusarium solani, from camptotheca acuminata, capable of biosynthesizing camptothecin (cpt, 1), but this capability substantially decreased on repeated subculturing. the endophyte with an impaired 1 biosynthetic capability was artificially inoculated into the living host plants and then recovered after colonization. although t ... | 2011 | 21348469 |
| [identification of pathogens causing root rot of sophora tonkinensis]. | to identify the pathogens what caused of root rot, it can provide method of theoretical gist of integrated pest management of these kinds of diseases in the future. | 2010 | 21355186 |
| [mycetoma caused by fusarium solani]. | | 2011 | 21367408 |
| accurate and practical identification of 20 fusarium species by seven-locus sequence analysis and reverse line blot hybridization, and an in vitro antifungal susceptibility study. | eleven reference and 25 clinical isolates of fusarium were subject to multilocus dna sequence analysis to determine the species and haplotypes of the fusarial isolates from beijing and shandong, china. seven loci were analyzed: the translation elongation factor 1 alpha gene (ef-1+¦); the nuclear rrna internal transcribed spacer (its), large subunit (lsu), and intergenic spacer (igs) regions; the second largest subunit of the rna polymerase gene (rpb2); the calmodulin gene (cam); and the mitochon ... | 2011 | 21389150 |
| antimicrobial efficacy of multi-purpose contact lens disinfectant solutions following evaporation. | non-compliance is a significant factor in contact lens related microbial keratitis and includes solution reuse and failure to recap the lens storage case resulting in evaporation effects. to address this, impact of partial evaporation on the antimicrobial efficacy of multipurpose contact lens care solutions was investigated. | 2011 | 21393050 |
| effect of bromine oxidation on high-performance thin-layer chromatography multi-enzyme inhibition assay detection of organophosphates and carbamate insecticides. | following high-performance thin-layer chromatography, thiophosphate pesticides, which inhibit choline esterases, are detectable using a multi-enzyme inhibition assay (hptlc-ei) based on rabbit liver esterase (rle), bacillus subtilis (bs2) esterase, or cutinase (from fusarium solani pisi). because choline esterase inhibition is more effective after conversion of thiophosphate thions into their corresponding oxons, a pre-oxidation step was added to the hptlc-ei assay. bromine vapour was found to b ... | 2011 | 21397236 |
| activation of focal adhesion kinase enhances the adhesion of fusarium solani to human corneal epithelial cells via the tyrosine-specific protein kinase signaling pathway. | to determine the role of the integrin-fak signaling pathway triggered by the adherence of f. solani to human corneal epithelial cells (hcecs). | 2011 | 21403855 |
| elimination of hydrophobic volatile organic compounds in fungal biofilters: reducing start-up time using different carbon sources. | fungal biofilters have been recently studied as an alternative to the bacterial systems for the elimination of hydrophobic volatile organic compounds (voc). fungi foster reduced transport limitation of hydrophobic vocs due to their hydrophobic surface and extended gas exchange area associated to the hyphal growth. nevertheless, one of their principal drawbacks is their slow growth, which is critical in the start-up of fungal biofilters. this work compares the use of different carbon sources (gly ... | 2010 | 21404250 |
| in vitro efficacy of a povidone-iodine 0.4% and dexamethasone 0.1% suspension against ocular pathogens. | to assess the efficacy of a povidone-iodine 0.4%-dexamethasone 0.1% suspension against bacterial, fungal, and acanthamoeba clinical isolates. | 2011 | 21420603 |
| characterization of rhizosphere bacteria for control of phytopathogenic fungi of tomato. | fluorescent pseudomonas spp., isolated from rhizosphere soil of tomato and pepper plants, were evaluated in vitro as potential antagonists of fungal pathogens. strains were characterized using the api 20ne biochemical system, and tested against the causal agents of stem canker and leaf blight (alternaria alternata f. sp. lycopersici), southern blight (sclerotium rolfsii sacc.), and root rot (fusarium solani). to this end, dual culture antagonism assays were carried out on 25% tryptic soy agar, k ... | 2011 | 21507555 |
| antifungal activity of rhizospheric bacteria. | fluorescent pseudomonad spp. were isolated from the rhizosphere of potato plants (algeria) by serial dilutions of rhizosphere soils on kings b medium and were tested for their antifungal activity. the antifungal activity of the pseudomonas isolated from potatoes rhizosphere was tested against pythium ultimum, rhizoctonia solani and fusarium oxysporum in dual culture with bacteria on pda. the petri dish was divided into tow, on one the bacteria was spread and on the opposite side fungal plugs wer ... | 2010 | 21534477 |
| synthesis, characterization and biological studies of sulfonamide schiff's bases and some of their metal derivatives. | a new series of schiff base ligands derived from sulfonamide and their metal(ii) complexes [cobalt(ii), copper(ii), nickel(ii) and zinc(ii)] have been synthesized and characterized. the nature of bonding and structure of all the synthesized compounds has been explored by physical, analytical and spectral data of the ligands and their metal(ii) complexes. the authors suggest that all the prepared complexes possess an octahedral geometry. the ligands and metal(ii) complexes have been screened for ... | 2011 | 21534864 |
| antifungal properties of wheat histones (h1-h4) and purified wheat histone h1. | wheat ( triticum spp.) histones h1, h2, h3, and h4 were extracted, and h1 was further purified. the effect of these histones on specific fungi that may or may not be pathogenic to wheat was determined. these fungi included aspergillus flavus , aspergillus fumigatus , aspergillus niger , fusarium oxysporum , fusarium verticillioides , fusarium solani , fusarium graminearum , penicillium digitatum , penicillium italicum , and greeneria uvicola . non-germinated and germinating conidia of these fung ... | 2011 | 21595494 |
| olecranon bursa with fusarium solani infection in an otherwise healthy patient. | | 2011 | 21605189 |
| importance of rub and rinse in use of multipurpose contact lens solution. | purpose.: the introduction of contact lens multipurpose disinfection solution (mpds) that can be used in conjunction with a "no-rub" regimen has simplified lens care requirements. once adhered to a surface, microorganisms can become less susceptible to disinfection. the aim of the study was to evaluate the effect of various regimen steps on the efficacy of mpds when used with silicone hydrogel and conventional lenses. methods.: commercially available mpdss containing polyquad or polyhexamethylen ... | 2011 | 21623253 |