| a set of serine proteinase paralogs are required for blood-digestion in the ixodid tick haemaphysalis longicornis. | we present evidence demonstrating that genes encoding enzymes essential for successful blood-feeding are differentially induced in the midgut of the hard tick haemaphysalis longicornis. three serine proteinase genes (hlsp, hlsp2 and hlsp3) isolated from h. longicornis midgut exhibit protein sequence similarity with other trypsin-like serine proteinases reported from arthropods and vertebrate animal species. the endogenous enzymes were mainly detected in the midgut epithelial cells and in the lum ... | 2008 | 18775510 |
| ixodid ticks on dogs belonging to people in rural communities and villages in maputo province, mozambique. | the species composition and geographic distribution of ixodid ticks infesting domestic dogs owned by people in rural communities and villages in maputo province was established by collecting ticks from dogs at each of 27 localities spread throughout the province. ticks were collected from a total of 132 dogs, and nine species belonging to four genera were identified. one dog was infested with six species, three with five and 13 with four species. haemaphysalis elliptica followed by rhipicephalus ... | 2008 | 18788203 |
| haemaphysalis ratti, a new species of tick from rats in new guinea and haemaphysalis krijgsmani, new name for haemaphysalis novaeguineae krijgsman and ponto, 1932, pre-occupied. | | 1948 | 18856301 |
| a rickettsial disease in east africa transmitted by ticks (rhipicephalus simus and haemaphysalis leachi). | | 1947 | 18898709 |
| detection of a novel francisella in dermacentor reticulatus: a need for careful evaluation of pcr-based identification of francisella tularensis in eurasian ticks. | francisella tularensis, the causative agent of tularemia, has been detected in ixodid ticks in some regions of north america, europe, and asia. in the present study, 245 dermacentor reticulatus, 211 ixodes ricinus, and 194 haemaphysalis concinna adults from hungary were tested for the presence of f. tularensis by polymerase chain reaction (pcr) assays based on 16s ribosomal rna (16s rdna) and t-cell epitope of a francisella membrane protein (tul4). no francisella-specific amplification products ... | 2008 | 18945184 |
| characterization of a concealed antigen hq05 from the hard tick haemaphysalis qinghaiensis and its effect as a vaccine against tick infestation in sheep. | positive clone hq05 of haemaphysalis qinghaiensis (named following those cdna clones cloned from the tick before) was obtained by differentially screening of a cdna library of the tick with rabbit anti-tick salivary gland serum and rabbit anti-tick saliva serum. hq05 contains an open reading frame (orf) of 540bp that codes for 179amino acid residues with a coding capacity of 20kda. sequence similarity and phylogenetic analyses indicated that hq05 was a novel gene. expression analysis by reverse ... | 2009 | 19010370 |
| molecular characterization of rickettsia rickettsii isolated from human clinical samples and from the rabbit tick haemaphysalis leporispalustris collected at different geographic zones in costa rica. | five strains of spotted fever group (sfg) rickettsiae previously isolated from human clinical cases and from the tick haemaphysalis leporispalustris were used for molecular characterization in this study to establish their genetic relationship compared with the prototype rickettsia rickettsii strain sheila smith. samples were tested by polymerase chain reaction (pcr) targeting the rickettsial genes gtla, ompa, and ompb. pcr products of the latter two genes were dna sequenced and compared with av ... | 2008 | 19052300 |
| hemalin, a thrombin inhibitor isolated from a midgut cdna library from the hard tick haemaphysalis longicornis. | a full-length sequence of a thrombin inhibitor (designated as hemalin) from the midgut of parthenogenetic haemaphysalis longicornis has been identified. sequence analysis shows that this gene belongs to the kunitz-type family, containing two kunitz domains with high homology to boophilin, the thrombin inhibitor from rhipicephalus (boophilus) microplus. the recombinant protein expressed in insect cells delayed bovine plasma clotting time and inhibited both thrombin-induced fibrinogen clotting and ... | 2009 | 19061894 |
| experimental infection of the rabbit tick, haemaphysalis leporispalustris, with the bacterium rickettsia rickettsii, and comparative biology of infected and uninfected tick lineages. | the present study consisted of two experiments that evaluated experimental infections of haemaphysalis leporispalustris ticks by a brazilian strain of rickettsia rickettsii, and their effect on tick biology. in experiment i, ticks were exposed to r. rickettsii during the larval, nymphal or adult stages by feeding on rabbits (oryctolagus cuniculus) needle-inoculated with r. rickettsii, and thereafter reared on uninfected rabbits for the entire next tick generation. regardless of the tick stage th ... | 2009 | 19067185 |
| characterization of an intracellular cystatin homolog from the tick haemaphysalis longicornis. | cystatins are tight-binding inhibitors of papain-like cysteine proteases. on the basis of amino acid sequencing, cystatins can be subdivided into three closely related families, family 1, family 2 and family 3. among them, only family 1 cystatins are intracellular. in this report, a gene encoding family 1 cystatin from tick haemaphysalis longicornis (hlcyst-1) has been identified. its full-length cdna is 437 bp, including an intact orf encoding an expected protein with 98 amino acids. sequence a ... | 2009 | 19091470 |
| rickettsial agents in slovakian ticks (acarina, ixodidae) and their ability to grow in vero and l929 cell lines. | a total of 80 adult ticks (55 haemaphysalis inermis, 12 dermacentor reticulatus, 11 d. marginatus, 2 ixodes ricinus) were collected from vegetation in three areas of slovakia (forest and pasture habitat) in central europe. forty-six (46 ticks) (57.5%) of all species tested were positive by the hemocyte test, pcr assays based on the glta and ompa genes showed a rickettsiaceae infection in 77.5% of the ticks, whereas only one h. inermis tick was positive for anaplasmataceae on a 16s rrna-based pcr ... | 2008 | 19120229 |
| distribution and molecular detection of theileria and babesia in questing ticks from northern spain. | a total of 562 questing adult ixodid ticks, collected during 2003-05 in 10 recreational mountain areas in northern spain, were analysed for piroplasm infection. reverse line blot (rlb) analysis using a panel of probes for 23 piroplasm species identified 16 different piroplasms, with an overall prevalence of 9.3%. most were theileria spp.-positive (7.7%), 3.0% were positive for babesia spp. and 1.4% of ticks harboured both genera. ixodes ricinus (linnaeus, 1758), the most abundant tick in the veg ... | 2008 | 19120958 |
| developmental stage- and organ-specific expression profiles of asparaginyl endopeptidases/legumains in the ixodid tick haemaphysalis longicornis. | we previously identified two cdnas from the midgut of adult haemaphysalis longicornis that encode asparaginyl endopeptidases/legumains, hllgm and hllgm2. functionally, both recombinant hllgm and hllgm2 efficiently digested blood proteins, haemoglobin and bovine serum albumin. here, we investigated the expression profiles of legumain genes in the developmental stages in the life cycle of h. longicornis and in different tissues of adult ticks. both hllgm and hllgm2 were well expressed in larvae, n ... | 2008 | 19122407 |
| searching for generality in the patterns of parasite abundance and distribution: ectoparasites of a south african rodent, rhabdomys pumilio. | we studied abundance and distribution of seven ectoparasite species (fleas chiastopsylla rossi and dynopsyllus ellobius, a louse polyplax arvicanthis, mites androlaelaps fahrenholzi and laelaps giganteus and two ticks haemaphysalis elliptica and hyalomma truncatum) exploiting the same populations of the rodent host rhabdomys pumilio in south africa. we considered three general patterns of abundance and distribution, namely (i) aggregated distribution of parasites amongst individual hosts; (ii) p ... | 2009 | 19168068 |
| comments on controversial tick (acari: ixodida) species names and species described or resurrected from 2003 to 2008. | there are numerous discrepancies in recent published lists of the ticks of the world. here we review the controversial names, presenting evidence for or against their validity and excluding some altogether. we also address spelling errors and present a list of 17 species described or resurrected during the years 2003-2008. we consider the following 35 tick species names to be invalid: argas fischeri audouin, 1826, ornithodoros boliviensis kohls and clifford, 1964, ornithodoros steini (schulze, 1 ... | 2009 | 19169832 |
| ecological aspects of the free-living ticks (acari: ixodidae) on animal trails within atlantic rainforest in south-eastern brazil. | in a recent ecological study of the ticks on animal trails within an area of atlantic rainforest in south-eastern brazil, amblyomma aureolatum, a. brasiliense, a. incisum, a. ovale and haemaphysalis juxtakochi were found questing on the vegetation. most of the ticks recorded by a small, man-made dam on the forest border were a. dubitatum but a few a. brasiliense and a. cajennense, one a. incisum and one h. juxtakochi were also found. the seasonal activity of the ticks indicated that a. incisum a ... | 2009 | 19173777 |
| [detection of co-infection with lyme spirochetes and spotted fever group rickettsiae in a group of haemaphysalis longicornis]. | the present study was conducted to investigate the infection of lyme disease, spotted fever, ehrlichiosis (anaplasmosisin) in wild animals and ticks in the mountain areas of zhejiang province. | 2008 | 19173967 |
| effect of vaccination with a recombinant metalloprotease from haemaphysalis longicornis. | we report the cloning, expression and characterization of an haemaphysalis longicornis metalloprotease (named hlmp1). the gene encodes a predicted 550 aminoacid protein with similarity to metalloproteases of the reprolysin family. the protein sequence contains a signal sequence, the zinc-binding motif (hexxhxxgxxh) common to metalloproteases and a cysteine-rich region. reverse transcription-pcr expression analysis indicates the presence of mrna in the salivary gland of larva, nymph and adult tic ... | 2009 | 19184465 |
| molecular analysis of ixodes granulatus, a possible vector tick for borrelia burgdorferi sensu lato in taiwan. | the genetic identity of ixodes granulatus ticks was determined for the first time in taiwan. the phylogenetic relationships were analyzed by comparing the sequences of mitochondrial 16s ribosomal dna gene obtained from 19 strains of ticks representing seven species of ixodes and two outgroup species (rhipicephalus sanguineus and haemaphysalis inermis). four major clades could be easily distinguished by neighbour-joining analysis and were congruent by maximum-parsimony method. all these i. granul ... | 2009 | 19184580 |
| autophagy in ticks. | the generation time of ticks is estimated at several years and most ticks spend more than 95% of their life off the host. they seem to have a unique strategy to endure the off-host state for a long period. we focused on autophagy that is induced by starvation and is essential for extension of the life span in model organisms. autophagy may occur in ticks that can survive extended periods of starvation. although little research has been done on autophagy in ticks, recently, we showed the existenc ... | 2008 | 19185742 |
| experimental transmission of theileria uilenbergi infective for small ruminants by haemaphysalis longicornis and haemaphysalis qinghaiensis. | the experimental transmission of a recently designated theileria uilenbergi pathogenic for sheep and goats in northern china is described. haemaphysalis qinghaiensis nymphs and adults developed from larvae and nymphs engorged on sheep infected with t. uilenbergi were able to respectively transmit the latter to sheep. however, when h. longicornis ticks picked up t. uilenbergi either at larval or nymphal, only the subsequent adult could transmit the parasites to sheep, the subsequent nymph could n ... | 2009 | 19198881 |
| influence of biotope on the distribution and peak activity of questing ixodid ticks in hungary. | in order to update the occurrence of hard tick species in hungary, 3442 questing ticks were collected from the vegetation by the dragging/flagging method in 37 different places in the country, between march and june of 2007. ixodes ricinus (l.) turned out to be ubiquitous. dermacentor marginatus (schulzer) was absent from sampling sites in the southwestern part of the country, but in most places was concomitant and contemporaneous with dermacentor reticulatus (fabricius). these two species, as w ... | 2009 | 19239612 |
| comparative ompa gene sequence analysis of rickettsia felis-like bacteria detected in haemaphysalis sulcata ticks and isolated in the mosquito c6/36 cell line. | | 2009 | 19298401 |
| blocking the secretion of saliva by silencing the hlykt6 gene in the tick haemaphysalis longicornis. | soluble n-ethylmaleimide-sensitive fusion protein attachment protein receptors (snares) have been identified as the key components of the protein complexes that facilitate vesicle traffic, of which ykt6 (from saccharomyces cerevisiae, v-snare) is proved to be a multifunctional protein in the membrane fusion. in the present study, a tick homologue of ykt6 (hlykt6, predicted 22.6 kda), was isolated from the ixodid tick haemaphysalis longicornis. rt-pcr and western blot analysis indicated that the ... | 2009 | 19328851 |
| cloning and molecular characterization of tick kynurenine aminotransferase (hlkat) from haemaphysalis longicornis (acari: ixodidae). | a complementary dna coding a novel kynurenine aminotransferase (kat) molecule from haemaphysalis longicornis tick embryo was cloned and characterized. the transcription of the hlkat occurs at all stages during tick development as well as in the midgut, salivary glands, ovary, and synganglion of adult ticks, and protein expression levels increased during the blood-feeding course. the hlkat gene without signal peptide was successfully expressed as a glutathione s-transferase fusion protein in solu ... | 2009 | 19381689 |
| allochronic seasonal peak activities of dermacentor and haemaphysalis spp. under continental climate in hungary. | hard ticks (acari: ixodidae) were collected from the vegetation at monthly intervals in 2008 on six places of three different biotopes in hungary. except for haemaphysalis concinna and h. punctata, predominance of females was observed in the questing population. from among the species with biphasic activity period, metastriate ticks (dermacentor spp. and h. inermis) had higher prevalence of host-seeking males in the autumn than in the spring, as opposed to prostriate ixodes ricinus. in compariso ... | 2009 | 19410373 |
| hemoglobinase activity of a cysteine protease from the ixodid tick haemaphysalis longicornis. | we report here the molecular characterization and possible function of a cysteine protease (termed hlcpl-a) identified in the midgut of the hard tick haemaphysalis longicornis. hlcpl-a is a 333 amino acid protein belonging to the papain family of the cysteine protease. a construct encoding prohlcpl-a was expressed in escherichia coli and purified as both procathepsin l and active processed cathepsin l forms. the hlcpl-a gene expression was up-regulated by blood-feeding process. hlcpl-a exhibited ... | 2009 | 19446040 |
| [construction of cdna expression library of unfed female haemaphysalis longicornis and immuno-screening]. | to construct a cdna expression library from unfed female tick haemaphysalis longicornis for screening and cloning potential antigenic genes. | 2009 | 19459491 |
| molecular characterization of hard and soft ticks from romania by sequences of the internal transcribed spacers of ribosomal dna. | in the present study, four hard tick species and one soft tick species, namely, dermacentor marginatus, haemaphysalis punctata, haemaphysalis parva, ixodes ricinus, and dermanyssus gallinae, from south-western romania were characterized genetically by the first (its-1) and second (its-2) internal transcribed spacers (its) of nuclear ribosomal dna (rdna), using a hard tick, haemaphysalis longicornis, from china for comparative purposes. the its rdna was amplified by polymerase chain reaction (pcr ... | 2009 | 19462182 |
| leucine aminopeptidase in the ixodid tick haemaphysalis longicornis: endogenous expression profiles in midgut. | we previously identified a cdna from the ixodid tick haemaphysalis longicornis that encodes leucine aminopeptidase, hllap. functionally, recombinant hllap effectively hydrolyzed synthetic amino acid derivatives. here, we investigated the temporal expression profiles of midgut hllap in adult h. longicornis parthenogenetic ticks from the starting of blood feeding until just before the onset of oviposition. midgut hllap transcript expression level was higher during post-engorgement period than that ... | 2009 | 19498284 |
| comparative immunogenicity of haemaphysalis longicornis and rhipicephalus (boophilus) microplus calreticulins. | the ticks rhipicephalus (boophilus) microplus and haemaphysalis longicornis are blood-sucking ectoparasites of bovines, causing serious damages to the livestock production. the main control method for these ticks is based on acaricides. however, the use of vaccines has been studied as a promising control strategy. calreticulin (crt) is a multifunctional, predominantly intracellular protein present in almost all cells of animals. the secretion of crt during feeding might be linked to the modulati ... | 2009 | 19560273 |
| vaccination effects of recombinant chitinase protein from the hard tick haemaphysalis longicornis (acari: ixodidae). | the success of immunological method for the control of ticks depend on the use of potential key antigens as tick vaccine candidates. chitinase is induced by ecdysteroids to degrade the older chitin at the time of molting. previously, we cloned a gene encoding 113 kda protein (cht1) of haemaphysalis longicornis, and identified the cht1 as a protein of chitinase (you et al. 2003). in this study, the recombinant cht1 (rcht1) expressed in escherichia coli was used to immunize mice. the mice were cha ... | 2009 | 19578277 |
| the kunitz-like modulatory protein haemangin is vital for hard tick blood-feeding success. | ticks are serious haematophagus arthropod pests and are only second to mosquitoes as vectors of diseases of humans and animals. the salivary glands of the slower feeding hard ticks such as haemaphysalis longicornis are a rich source of bioactive molecules and are critical to their biologic success, yet distinct molecules that help prolong parasitism on robust mammalian hosts and achieve blood-meals remain unidentified. here, we report on the molecular and biochemical features and precise functio ... | 2009 | 19593376 |
| molecular investigation of hard ticks (acari: ixodidae) and fleas (siphonaptera: pulicidae) as potential vectors of rickettsial and mycoplasmal agents. | the aim of the present study was twofold. first, in general, to reveal new aspects of the potential vector role of ixodid ticks and fleas by screening large numbers of specimens with recently developed molecular biological methods. second, to evaluate the occurrence of vector-borne infectious agents in a geographical context. altogether 3442 unfed hard ticks (ixodes ricinus, dermacentor marginatus, d. reticulatus, haemaphysalis inermis, h. concinna, h. punctata) and 939 fleas of cats and dogs (c ... | 2010 | 19660880 |
| rickettsia hoogstraalii sp. nov., isolated from hard- and soft-bodied ticks. | a novel spotted fever group rickettsia was found in haemaphysalis sulcata ticks collected from sheep and goats in croatia in 2006. at the same time, a genetically identical organism was co-isolated with the embryonic cell line cce3 obtained from the soft tick carios capensis in georgia, usa. in this study, further phenotypic and genotypic characteristics of the novel rickettsial strain present in h. sulcata ticks were investigated. based on the cultivation of bacteria in mosquito and vero cell c ... | 2010 | 19666817 |
| lkr/sdh plays important roles throughout the tick life cycle including a long starvation period. | lysine-ketoglutarate reductase/saccharopine dehydrogenase (lkr/sdh) is a bifunctional enzyme catalyzing the first two steps of lysine catabolism in plants and mammals. however, to date, the properties of the lysine degradation pathway and biological functions of lkr/sdh have been very little described in arthropods such as ticks. | 2009 | 19774086 |
| a salivary cystatin, hlsc-1, from the ixodid tick haemaphysalis longicornis play roles in the blood-feeding processes. | ticks feed exclusively on blood to obtain their nutrients, but the gene products that mediate blood-sucking processes in ticks are still unknown. we report here the molecular characterization and possible biological function of a cysteine protease inhibitor (hlsc-1) identified in the salivary gland of the ixodid tick haemaphysalis longicornis. the hlsc-1 cdna contains 423 bp that code for 140 amino acids with a predictable molecular weight of 12 kda. the recombinant hlsc-1 expressed in escherich ... | 2009 | 19779741 |
| adulticidal and larvicidal efficacy of some medicinal plant extracts against tick, fluke and mosquitoes. | the adulticidal and larvicidal effect of indigenous plant extracts were investigated against the adult cattle tick haemaphysalis bispinosa neumann, 1897 (acarina: ixodidae), sheep fluke paramphistomum cervi zeder, 1790 (digenea: paramphistomatidae), fourth instar larvae of malaria vector, anopheles subpictus grassi and japanese encephalitis vector, culex tritaeniorhynchus giles (diptera: culicidae). the aim of this study was to evaluate the toxic effect of leaf hexane, chloroform, ethyl acetate, ... | 2009 | 19819626 |
| molecular detection of ehrlichia chaffeensis and anaplasma bovis in the salivary glands from haemaphysalis longicornis ticks. | the salivary gland (sg) of tick plays an important role as a route in the dissemination of tick-borne pathogens to their hosts. we evaluated the presence of these pathogens in the sgs of haemaphysalis longicornis ticks, and these ticks were collected from grazing cattle in jeju island, korea. of total 463 one-side sgs, 56 (12.1%) sgs were positive for ehrlichia chaffeensis and 11 (2.4%) were positive for anaplasma bovis. in addition, two (0.4%) sgs were co-infected with both e. chaffeensis and a ... | 2010 | 19874189 |
| detection of anaplasma bovis and anaplasma phagocytophilum dna from haemaphysalis megaspinosa in hokkaido, japan. | dna from 101 ticks, including haemaphysalis megaspinosa, haemaphysalis douglasi, haemaphysalis flava, ixodes ovatus and ixodes persulcatus, collected by flagging in a pasture in hidaka district (hokkaido, japan) was examined for infection with anaplasma bovis and a. phagocytophilum by species-specific nested pcr. of the 48 h. megaspinosa nymphs, examined, 1 (2.1%) and 6 (12.5%) were positive for a. bovis and a. phagocytophilum, respectively. one of the 6 positive nymphs was dual positive for bot ... | 2010 | 19897306 |
| 16s rrna gene-based identification of cultured bacterial flora from host-seeking ixodes ricinus, dermacentor reticulatus and haemaphysalis concinna ticks, vectors of vertebrate pathogens. | a total of 151 bacterial isolates were recovered from different developmental stages (larvae, nymphs and adults) of field-collected ticks (67 strains from ixodes ricinus, 38 from dermacentor reticulatus, 46 from haemaphysalis concinna). microorganisms were identified by means of 16s rrna gene sequencing. almost 87 % of the strains belonged to g(+) bacteria with predominantly occurring genera bacillus and paenibacillus. other g(+) strains included arthrobacter, corynebacterium, frigoribacterium, ... | 2009 | 19937215 |
| structural characterization and cytolytic activity of a potent antimicrobial motif in longicin, a defensin-like peptide in the tick haemaphysalis longicornis. | longicin, a defensin-like peptide, was recently identified in the hard tick haemaphysalis longicornis. longicin and one of its synthetic partial analogs (p4) displayed antimicrobial/fungicidal/parasiticidal activity. in the present study, we compared longicin-derived synthetic analogs in order to characterize the antimicrobial motif (p4) by analyzing some structural features using various bioinformatic tools and/or cd spectroscopy. according to the chemicophysical characteristics, p4 is suggeste ... | 2010 | 19940394 |
| ectoparasites (sucking lice, fleas and ticks) of small mammals in southeastern kenya. | during 1998-2000, at least 14 species (n = 309) of small mammals were live-trapped and examined for ectoparasites in moist forests of the taita and shimba hills and drier savannah habitats of nguruman, southeastern kenya. ectoparasites were recorded from 11 species of mammals. five species of sucking lice [hoplopleura inexpectans johnson, h. intermedia kellogg & ferris, polyplax reclinata (nitzsch), p. waterstoni bedford and schizophthirus graphiuri ferris], six species of fleas (ctenophthalmus ... | 2009 | 19941604 |
| longistatin, a novel ef-hand protein from the ixodid tick haemaphysalis longicornis, is required for acquisition of host blood-meals. | calcium and the ef-hand ca(++)-binding proteins have been undisputedly recognised as the key players in almost all aspect of cell functions, starting from the cell's birth, during mitosis to its end with apoptosis. but in a few exceptional cases the ef-hand proteins are secreted from the cells and play their crucial roles extracellularly. here, to our knowledge for the first time, we have identified and characterised an ef-hand ca(++)-binding protein from the salivary glands of the ixodid tick, ... | 2010 | 19968997 |
| detection of bartonella tamiae dna in ectoparasites from rodents in thailand and their sequence similarity with bacterial cultures from thai patients. | ectoparasites, including chigger mites (genera leptotrombidium, schoengastia, and blankarrtia) and one tick (genus haemaphysalis) collected from wild-caught rodents in thailand, were assessed for the presence of bartonella dna by using a polymerase chain reaction assay targeting the 16s-23s intergenic spacer region and citrate synthase gene (glta). of the 41 pooled samples tested, 34 were positive for bartonella dna. sequence analysis demonstrated that dna detected in 33 chigger mite pools and o ... | 2010 | 20017718 |
| a kunitz-type proteinase inhibitor from the midgut of the ixodid tick, haemaphysalis longicornis, and its endogenous target serine proteinase. | although previous studies strongly suggested the involvement of serine proteases in blood digestion in the midgut of ticks, the regulating molecules of these proteinases are still unidentified. a novel haemaphysalis longicornis kunitz-type serine proteinase inhibitor with a single kunitz-domain (hlmki) has been identified and its co-localization with a midgut-derived serine proteinase (hlsp) within the epithelial cells has been demonstrated. recombinant hlmki inhibited the hydrolytic activity of ... | 2010 | 20026198 |
| babesia sp. bq1 (lintan): molecular evidence of experimental transmission to sheep by haemaphysalis qinghaiensis and haemaphysalis longicornis. | ovine babesiosis is an economically important disease induced by tick transmitted haemoparasites throughout the world. in china, several ovine babesia strains have been isolated from field-collected ticks or sheep blood during the last two decades but little is known about the vector ticks and transmission pattern. babesia sp. bq1 (lintan) is a babesia strain infective for sheep and goats, isolated from blood of sheep experimentally infested with haemaphysalis qinghaiensis collected in field. in ... | 2010 | 20026243 |
| a novel defensin-like peptide from salivary glands of the hard tick, haemaphysalis longicornis. | a novel defensin-like antimicrobial peptide named longicornsin was isolated from the salivary glands of the hard tick, haemaphysalis longicornis, using a 10-kda cut-off centriprep filter and reversed-phase high-performance liquid chromatography (rp-hplc). its amino acid sequence was determined as dfgcgqgmifmcqrrcmrlypgstgfcrgfrcmcdthiplrppfmvg by edman degradation. the cdna encoding longicornsin was cloned by cdna library screening. the predicted protein from the cdna sequence was composed of 78 ... | 2010 | 20027626 |
| gata transcription, translation and regulation in haemaphysalis longicornis tick: analysis of the cdna and an essential role for vitellogenesis. | blood feeding tightly regulates the reproductive cycles of ticks. vitellogenesis and nutritional signaling are key events in the tick reproductive cycle. here we report the identification of a gata factor that is synthesized after a blood meal and acts as a transcriptional activator of vitellogenin (vg), and the identification of an s6 kinase that is a transcription regulator of the amino acid signaling pathway. tick gata mrna accumulated in the midgut prior to blood feeding. however, translatio ... | 2010 | 20040373 |
| parasites of the brush-tailed rock-wallaby (petrogale penicillata). | the brush-tailed rock-wallaby (petrogale penicillata) is listed as vulnerable on the international union for conservation of nature (iucn) red list of threatened species. parasitic diseases have been proposed as possible contributing factors to the decline of the species, but very little is known about the effects of parasites on this host. this study determined the antibody prevalence of the protist toxoplasma gondii in a wild brush-tailed rock-wallaby population from three neighboring colonies ... | 2010 | 20090035 |
| ganjam virus. | ganjam virus (ganv), a member of genus nairovirus of family bunyavirdae is of considerable veterinary importance in india. though, predominantly tick borne, ganv was also isolated from mosquitoes, man and sheep. neutralizing and complement fixing antibodies to ganv have been detected in animal and human sera collected from different parts of the country. thirty three strains of ganv have been isolated from india, mainly from haemaphysalis ticks. the virus replicated in certain vertebrate and mos ... | 2009 | 20090098 |
| ticks (acari: ixodoidea: argasidae, ixodidae) of china. | this paper presents results of an investigation and listing of tick species found in china during a survey in all 28 provinces. this will be a step towards a definitive list of tick species and their distribution. to date, the tick fauna of this area consists of 117 species in the following families: argasidae-argas (7 species), carios (4 species) and ornithodoros (2 species); ixodidae-amblyomma (8 species), anomalohimalaya (2 species), dermacentor (12 species), haemaphysalis (44 species), hyalo ... | 2010 | 20101443 |
| hlcyst-1 and hlcyst-2 are potential inhibitors of hlcpl-a in the midgut of the ixodid tick haemaphysalis longicornis. | although the actions of cysteine proteases are controlled in part by endogenous tight-binding cysteine protease inhibitors from the cystatin superfamily, regulatory mechanisms used by ticks to control protease activities are unknown. we report here the interaction of 2 endogenous midgut cysteine protease inhibitors, hlcyst-1 and hlcyst-2, with an endogenous midgut cysteine protease, hlcpl-a in haemaphysalis longicornis. in vitro inhibition assays demonstrated that the hydrolytic activity of hlcp ... | 2010 | 20103991 |
| characterization of hlcyst-3 as a member of cystatins from the tick haemaphysalis longicornis. | the gene encoding cystatin from the tick haemaphysalis longicornis has been reported previously. in the study reported here, we characterized a member of cystatins and designated it as hlcyst-3 (h. longicornis cystatin-3). its full-length cdna is 602 bp, and it encodes a putative 129 amino acid protein with an obvious signal peptide. sequence analysis revealed that it has significant homology with the known secreted cystatin. the recombinant protein was expressed in a gst-fused soluble form in e ... | 2010 | 20107871 |
| merozoite proteins from babesia sp. bq1 (lintan) as potential antigens for serodiagnosis by elisa. | babesia sp. bq1 (lintan) is a babesia isolated from sheep infested with haemaphysalis qinghaiensis in china, and is closely related to b. motasi based on the 18s rrna gene sequence. in the present study, an elisa was developed with merozoite antigens of babesia sp. bq1 (lintan) (bqma) purified from in vitro culture. when the positive threshold was chosen as 30% of the antibodies rate, evaluated with 198 negative sera, the specificity was 95.5%. except for babesia sp. tianzhu, there was no cross- ... | 2010 | 20109252 |
| ticks (acari: ixodidae) infesting wild birds in the eastern amazon, northern brazil, with notes on rickettsial infection in ticks. | the aim of the study was to report tick infestations on wild birds in a region of the eastern brazilian amazon and evaluate the rickettsial infection of these ticks. wild birds captured by mist nets were examined for the presence of ticks, which were collected and identified to species by morphology or molecular methods. in addition, part of these ticks was individually tested by polymerase chain reaction targeting portions of the rickettsial genes glta and ompa. among 331 captured birds, repres ... | 2010 | 20140452 |
| biogeography of tick-borne bhanja virus (bunyaviridae) in europe. | bhanja virus (bhav) is pathogenic for young domestic ruminants and also for humans, causing fever and affections of the central nervous system. this generally neglected arbovirus of the family bunyaviridae is transmitted by metastriate ticks of the genera haemaphysalis, dermacentor, hyalomma, rhipicephalus, boophilus, and amblyomma. geographic distribution of bhav covers southern and central asia, africa, and southern (partially also central) europe. comparative biogeographic study of eight know ... | 2010 | 20182535 |
| [characterization of follistatin-related protein from the hard tick haemaphysalis longicornis]. | we designed the primers based on the sequence of the follistatin-related protein from haemaphysalis longicornis okayama strain accessed in genbank. we cloned a gene encoding follistatin-related protein by rt-pcr, and the length cdna is 814 bp, encoding a deduced protein of 289 amino acids. the alignment with the sequence of follistatin-related protein from the h. longicornis okayama strain showed that the percent of nucleotide sequence and amino acid sequence is 97.8% and 99%, respectively. the ... | 2009 | 20222462 |
| determination of erythrocyte susceptibility of chinese sheep (tan mutton breed) and french sheep (vendéen breed) to babesia sp. bq1 (lintan) by in vitro culture. | the babesia species "bq1 (lintan)" is infective to sheep and goats. the species was isolated from haemaphysalis qinghaiensis collected in the gannan tibet autonomous region, china in april 2000. in this study, an in vitro culture system was developed for the propagation of babesia sp. bq1 (lintan). continuous cultivation and 5.0% parasitemia was obtained in vitro in rpmi 1640 medium with sheep red blood cells (rbc) (7.5%) supplemented with fetal bovine serum (fbs) (20%), amphotericin b (0.5 micr ... | 2010 | 20223592 |
| leucine aminopeptidase, hllap, from the ixodid tick haemaphysalis longicornis, plays vital roles in the development of oocytes. | female ixodid ticks are amazing invertebrate animals which efficiently convert a large amount of nutrients derived from their ingested blood meals into eggs. although oocyte development (vitellogenesis) in ticks is triggered by a blood meal and is assumed to be supported by nutrition derived from ovarian cells connecting oocytes, little is known about the ovarian molecules processing nutrient materials for the vitellogenesis. in this study, we have suggested a putative function of leucine aminop ... | 2010 | 20230906 |
| ectoparasite fauna of rodents and shrews from four habitats in kuala lumpur and the states of selangor and negeri sembilan, malaysia and its public health significance. | a total of 204 rodents comprising 14 host species from four different habitats were examined. nine rodent species were trapped from the forest and another five species were trapped from the coastal, rice field and urban habitats. rattus rattus diardii (67%) was the predominant rodent species examined. fifty six (47.3%) rodents and shrews were found to be infested with at least one of the 20 species of ectoparasite recovered. mites belonging to the family trombiculidae were the predominant ectopa ... | 2009 | 20237444 |
| evaluation of medicinal plant extracts against blood-sucking parasites. | the present study was based on assessments of the antiparasitic activities to determine the efficacies of acetone, chloroform, ethyl acetate, hexane, and methanol dried leaf, flower, and seed extracts of cassia auriculata l., rhinacanthus nasutus kurz., solanum torvum swartz, terminalia chebula retz., and vitex negundo linn. were tested against larvae of cattle tick rhipicephalus (boophilus) microplus canestrini, 1887 (acari: ixodidae), adult of haemaphysalis bispinosa neumann, 1897 (acarina: ix ... | 2010 | 20306205 |
| increased expression of atg genes during nonfeeding periods in the tick haemaphysalis longicornis. | ticks are long-lived hematophagous arthropods and have tolerance to starvation. they can survive without food during the host-seeking period for several months to years. to understand how ticks obtain energy over a long period of nonfeeding (starvation), we focused on autophagy, a crucial proteolysis system via the lysosomes for various cellular processes that is induced during starvation in eukaryotes. in the present study, es t databases for several organs of the tick haemaphysalis longicornis ... | 2010 | 20404490 |
| evaluation of botanical extracts against haemaphysalis bispinosa neumann and hippobosca maculata leach. | in the current study, in vitro evaluation of crude hexane, chloroform, ethyl acetate, acetone, and methanol extracts of anisomeles malabarica (l.) r. br., gloriosa superba l., psidium guajava l., ricinus communis l., and solanum trilobatum l. exhibited acaricidal and insecticidal activities against the adult of haemaphysalis bispinosa neumann (acarina: ixodidae) and hematophagous fly hippobosca maculata leach (diptera: hippoboscidae). all plant extracts showed moderate toxic effect on parasites ... | 2010 | 20467752 |
| genetic characterization of ticks from southwestern romania by sequences of mitochondrial cox1 and nad5 genes. | in the present study, samples representing three hard tick species and one soft tick species, namely dermacentor marginatus, haemaphysalis punctata, ixodes ricinus and argas persicus from southwestern romania, and one hard tick, haemaphysalis longicornis, from china were characterized genetically by a portion of mitochondrial cytochrome c oxidase subunit 1 gene (pcox1) and a portion of nicotinamide adenine dinucleotide dehydrogenase subunit 5 gene (pnad5). the pcox1 and pnad5 were amplified sepa ... | 2010 | 20473707 |
| [abundance of ixodid ticks (ixodidae) in pastures situated near villages of east kazakhstan province]. | abudance of adult ixodid ticks on pastures situated near villages of east kazakhstan province has been festinated using the method or exhaustive capture. the number of adult ticks collected by flagging in the pastures with different ecological conditions varied in spring and autumm periods from 513 to 1036 per hectare. dermacentor marginatus was found to be absolutely dominating species; d. reticulatus showed small abundance; ixodes pavlovskyi, i. persulcatus and haemaphysalis concinna occurred ... | 2010 | 20536009 |
| prevalence of tick-borne pathogens in ticks in sicily. | the prevalence of anaplasma, ehrlichia, rickettsia and babesia/theileria species was analysed in questing and feeding adult ticks in sicily. a total of 678 ticks were collected and analysed in this study. of these, 29 were questing ticks and 649 were collected from infested cattle, sheep, goats or dogs. tick species analysed included rhipicephalus bursa, r. turanicus, r. sanguineus, hyalomma lusitanicum, h. marginatum, dermacentor marginatus, ixodes ricinus, r. (boophilus) annulatus and haemaphy ... | 2010 | 20537102 |
| development of a loop-mediated isothermal amplification (lamp) assay for rapid diagnosis of babesia canis infections. | vector-borne diseases are rising in interest due to global warming, which is believed to impact on the distribution of vectors into new areas thus influencing the occurrence and epidemiology of vector-borne pathogens. babesia canis belongs to the piroplasmidae and there are three described subspecies, namely b. canis canis, b. canis rossi and b. canis vogeli. they are each transmitted by a different tick-species, dermacentor reticulatus, haemaphysalis leachi and rhipicephalus sanguineus, respect ... | 2010 | 20537107 |
| multiple vitellogenins from the haemaphysalis longicornis tick are crucial for ovarian development. | ovarian development and egg maturation are crucial processes for the success of reproduction in ticks. three full-length cdnas encoding the precursor of major yolk protein, vitellogenin, were obtained from cdna libraries of the haemaphysalis longicornis tick and designated as hlvg-1, hlvg-2 and hlvg-3. the hlvg mrnas were found in fed females with major expression sites in the midgut, fat body and ovary. native page and western blot demonstrated that hlvgs in the hemolymph, fat body and ovary of ... | 2010 | 20576517 |
| ticks species (ixodida) in the summit municipal park and adjacent areas, panama city, panama. | from september 2007 to september 2009, we studied the species of ticks present in the summit municipal park. ticks were extracted from zoo animals, free-living wild mammals and reptiles trapped, dead mammals on the roads and environment (ground and zoo burrows). a total of 2,649 ticks were collected: 2,167 immature stages (1,345 larvae and 822 nymphs) and 482 adults. seventeen species were identified: ornithodoros puertorricensis (argasidae), amblyomma auricularium, a. cajennense, a. calcaratum, ... | 2010 | 20585838 |
| ixodid ticks (acari: ixodidae) infesting humans in tokat province of turkey: species diversity and seasonal activity. | ixodid ticks (acari: ixodidae) are the major vectors of pathogens threatening animal and human health. tokat province, turkey, is a suitable habitat for extended tick activity with its moderate climate and vegetation. in the present study, we surveyed humans visiting health centers to determine the species diversity, geographical distribution, and seasonal activity of ixodid ticks infesting them. out of 5,999 adult ticks collected from humans from april to september, 2008, 800 ticks were identif ... | 2010 | 20618665 |
| cross immunity with haemaphysalis longicornis glutathione s-transferase reduces an experimental rhipicephalus (boophilus) microplus infestation. | recombinant glutathione s-transferase of haemaphysalis longicornis (rgst-hl) was expressed in escherichia coli, purified by affinity chromatography and used in the immunization of cattle. western blot analysis showed positive antibody response in cattle immunized with rgst-hl. the tests also showed that immunized bovine sera recognize native rhipicephalus microplus proteins in different tissue extracts. furthermore, the vaccine potential of rgst-hl was investigated against infestation of herefor ... | 2011 | 20619263 |
| the efficacy of a topically applied combination of cyphenothrin and pyriproxyfen against the southern african yellow dog tick, haemaphysalis elliptica, and the cat flea, ctenocephalides felis, on dogs. | the objective of this study was to determine the therapeutic and residual efficacy of a topically applied combination of cyphenothrin (40%) and pyriproxyfen (2%) against the tick haemaphysalis elliptica and the flea ctenocephalides felis on dogs. twelve dogs were infested with 50 ticks 2 days before they were treated and with approximately 100 fleas 6 days before treatment and again 2 days before treatment and with 50 ticks and approximately 100 fleas at weekly intervals thereafter. they were ra ... | 2010 | 20649152 |
| selective ablation of basophils in mice reveals their nonredundant role in acquired immunity against ticks. | ticks are ectoparasitic arthropods that can transmit a variety of microorganisms to humans and animals during blood feeding, causing serious infectious disorders, including lyme disease. acaricides are pharmacologic agents that kill ticks. the emergence of acaricide-resistant ticks calls for alternative control strategies for ticks and tick-borne diseases. many animals develop resistance to ticks after repeated infestations, but the nature of this acquired anti-tick immunity remains poorly under ... | 2010 | 20664169 |
| cloning and characterization of a ribosomal protein l24 from haemaphysalis longicornis eggs. | a fragment of ribosomal protein l24 was obtained from the complementary deoxyribonucleic acid (cdna) library of haemaphysalis longicornis eggs. the complete sequence of the clone was subsequently obtained using rapid amplification of the cdna ends (race). ribosomal protein l24 from h. longicornis had a high percentage similarity to this protein from different species. conserved domains were also identified in rpl24. real-time polymerase chain reaction (pcr) analysis showed that this gene is expr ... | 2010 | 20676684 |
| prevalence of tick-borne encephalitis virus in ticks from southern korea. | the prevalence of tick-borne encephalitis virus (tbev) in southern korea was determined by collecting ticks using tick drags. a total of 4,077 of 6,788 ticks collected were pooled (649 pools) according to collection site, species, and developmental stage and assayed for tbev. the tbev protein e and ns5 gene fragments were detected using rt-nested pcr in six pools of nymphs collected from jeju island (2,491 ticks). the minimum field detection rates for tbev were 0.17% and 0.14% for haemaphysalis ... | 2010 | 20706026 |
| tick surveillance in great britain. | the ability for public/veterinary health agencies to assess the risks posed by tick-borne pathogens is reliant on an understanding of the main tick vector species. crucially, the status, distribution, and changing trends in tick distribution and abundance are implicit requirements of any risk assessment; however, this is contingent on the quality of tick distribution data. since 2005 the health protection agency has promoted an enhanced tick surveillance program. through engagement with a variet ... | 2011 | 20849277 |
| identification and characterization of class b scavenger receptor cd36 from the hard tick, haemaphysalis longicornis. | scavenger receptors (srs) are cell-surface proteins and exhibit distinctive ligand-binding properties, recognizing a wide range of ligands that include microbial surface constituents and intact microbes. the class b scavenger receptor cd36 (srb) is predominantly expressed by macrophages and is considered important in innate immunity. we here show the identification and characterization of srb from the hard ixodid tick, haemaphysalis longicornis (hlsrb). the full-length cdna was 2,908 bp, includi ... | 2010 | 20872015 |
| pathogens and symbionts in ticks: a survey on tick species distribution and presence of tick-transmitted micro-organisms in sardinia, italy. | a total of 1485 adult ticks were collected from mammalian hosts in south-eastern sardinia, italy, during the years 2007-2008. ticks were identified and tested by pcr analysis for presence of rickettsia species of the spotted fever group, ehrlichia canis, anaplasma phagocytophilum, coxiella burnetii, bartonella species and leishmania species. among all tick species examined (rhipicephalus sanguineus, rhipicephalus turanicus, rhipicephalus bursa, rhipicephalus pusillus, hyalomma marginatum margina ... | 2010 | 20884769 |
| [detection of babesia spp. dna in small mammals and ixodic ticks on the territory of north ural, west siberia and far east of russia]. | totally, 932 small mammals and 458 questing adult ixodes persulcatus from sverdlovsk and novosibirsk regions and khabarovsk territory, as well as 128 haemaphysalis japonica, 34 h. concinna and 29 dermacentor silvarum from khabarovsk territory were examined for the presence of babesia by nested pcr based on the 18s rrna gene. babesia microti dna was found in samples of small mammals from all the studied regions--in 36.2% of samples from sverdlovsk region, 5.3% of samples from novosibirsk region, ... | 2010 | 20886686 |
| evaluation of medicinal plant extracts against ticks and fluke. | the present study was based on assessments of the antiparasitic activities to determine the efficacies of leaf hexane, chloroform, ethyl acetate, acetone and methanol extracts of aegle marmelos (linn.) correa ex roxb, andrographis lineata wallich ex nees., andrographis paniculata (burm.f.) wallich ex nees., cocculus hirsutus (l.) diels, eclipta prostrata l., and tagetes erecta l. against the adult cattle tick haemaphysalis bispinosa neumann 1897 (acarina: ixodidae), the larvae of rhipicephalus ( ... | 2010 | 20922419 |
| survey of ticks (acari: ixodidae) and their rickettsia in an atlantic rain forest reserve in the state of são paulo, brazil. | the current study investigated the occurrence of ticks and their rickettsiae in the serra do mar state park, which encompasses one of the largest atlantic rain forest reserves of brazil. from july 2008 to june 2009, a total of 2439 ticks (2,196 free living and 243 collected on hosts) was collected, encompassing the following 13 species: amblyomma aureolatum (pallas), amblyomma brasiliense aragao, amblyomma dubitatum neumann, amblyomma fuscum neumann, amblyomma incisum neumann, amblyomma longiros ... | 2010 | 20939390 |
| new tick records in rondônia, western brazilian amazon. | in the present study, we provide new tick records from vilhena municipality, in the southeast of the state of rondônia, northern brazil. ticks collected from a capybara, hydrochoerus hydrochaeris (linnaeus), were identified as amblyomma romitii tonelli-rondelli (1 female), and amblyomma sp. (1 larva). ticks collected from a harpy eagle, harpia harpyja (linnaeus), were identified as amblyomma cajennense (fabricius) (16 nymphs) and haemaphysalis juxtakochi cooley (1 nymph). ticks collected from a ... | 2010 | 20943027 |
| lice and ticks of the eastern rufous mouse lemur, microcebus rufus, with descriptions of the male and third instar nymph of lemurpediculus verruculosus (phthiraptera: anoplura). | sucking lice and ticks were collected from live-trapped eastern rufous mouse lemurs, microcebus rufus geoffroy, in and around the periphery of ranomafana national park, southeastern madagascar, from 2007 to 2009. samples of 53 sucking lice (insecta: phthiraptera: anoplura) and 28 hard ticks (acari: ixodidae) were collected from 36 lemur captures representing 26 different host individuals. all of the lice were lemurpediculus verruculosus (ward) (6 males, 46 females, 1 third instar nymph). only th ... | 2010 | 20950093 |
| ixodid ticks in bosnia and herzegovina. | ticks of the ixodidae family represent an enormous threat to human and animal health. from january to december 2004, a total of 10,050 ixodid ticks were collected from 26 areas in bosnia and herzegovina and determined to the species level. ticks were collected from dogs, sheep, cows, goats, rodents, humans and plants. ixodes ricinus was the most prevalent species, followed by dermacentor marginatus marginatus, rhipicephalus bursa, hyalomma marginatum marginatum, rhipicephalus sanguineus, haemaph ... | 2010 | 20967487 |
| [on certain groupings within the genus haemaphysalis c. l. koch and their taxonomic significance]. | | 1945 | 21000987 |
| detection of babesia and theileria species infection in cattle from portugal using a reverse line blotting method. | babesiosis and theileriosis are tick-borne diseases widespread in tropical and sub-tropical regions with high economic impact worldwide. in portugal there are at least 4 tick vectors known to be competent for the transmission of babesia and theileria sp. identified: rhipicephalus bursa, rhipicephalus (boophilus) annulatus, ixodes ricinus and haemaphysalis punctata. all these potential babesia and theileria tick vectors are widely distributed in portugal, although they are predominant in the sout ... | 2010 | 21036481 |
| fatal bovine anaplasmosis in a herd with new genotypes of anaplasma marginale, anaplasma ovis and concurrent haemoplasmosis. | haematological and molecular analysis of blood samples was carried out during an outbreak of bovine anaplasmosis in hungary. acute disease was observed in five animals, two of which died. anaplasma-carrier state was diagnosed in 69 (92%) of cattle. further evaluation of 24 blood samples revealed concurrent infections with mycoplasma wenyonii and 'candidatusm. haemobos' in 22 and 21 animals, respectively. in addition, two cows were identified with rickettsaemia. regarding molecular investigation ... | 2010 | 21094505 |
| species composition and geographic distribution of ticks infesting cattle, goats and dogs in a temperate and in a subtropical region of south-east africa. | the species and distribution of ticks infesting cattle, goats and dogs in the eastern region of the eastern cape province, south africa and maputo province, mozambique were determined from collections made from these animals at 72 localities in the former region and 30 in the latter. eleven ixodid and one argasid species were recovered in the eastern cape province and 15 ixodid species in maputo province. the most common ticks infesting cattle and goats in both provinces were amblyomma hebraeum, ... | 2009 | 21105593 |
| cloning, expression and evaluation of the efficacy of a recombinant haemaphysalis concinna hc-23 antigen in rabbits. | haemaphysalis concinna is wide spread in china, and negatively impacted on husbandry production and then resulted in severe economic losses. methods available for the control of ticks are mainly based on chemotherapy. however, this approach is associated with a number of disadvantages; searching for alternative tick control measures is necessary and vaccination is one of the best control strategies. through h. concinna hc-23 gene pcr amplification, cloning and sequencing, sequence analysis showe ... | 2010 | 21130192 |
| high incidence of rickettsiosis correlated to prevalence of rickettsia japonica among haemaphysalis longicornis tick. | endemic spotted fever group rickettsiosis was reported in shimane prefecture, japan. from an analysis of 14 clinical cases found in the endemic area, the infectious agent of spotted fever group rickettsiosis was identified as rickettsia japonica. in this study, we also found that rickettsia japonica was highly infected with the vector tick, haemaphysalis longicornis, in the endemic area. these findings suggest that the high incidence of rickettsiosis in shimane prefecture can be explained by the ... | 2010 | 21139348 |
| first detection of spotted fever group rickettsiae in ticks in serbia. | ticks can transmit multiple pathogenic bacteria responsible for diseases in animals and humans such as borrelia burgdorferi sensu lato, anaplasma phagocytophilum, and spotted fever group rickettsia sp. the current study aimed to investigate the presence of rickettsiae in ticks collected from seven localities in serbia. one hundred thirty-one (131) questing ticks belonging to 5 tick species (dermacentor marginatus, dermacentor reticulatus, haemaphysalis punctata, haemaphysalis concinna, and ixode ... | 2010 | 21142961 |
| investigation of the ecology of francisella tularensis during an inter-epizootic period. | abstract a 1-year study of the ecological cycle of francisella tularensis was performed in an enzootic area during an inter-epizootic period. the study was based on multiple sampling of all major constituents of the disease cycle. seroprevalence of tularemia in the european brown hare (lepus europaeus) population was 5.1% (10/197) with low antibody titers (1/10 and 1/20), and f. tularensis ssp. holarctica was isolated from four hares. f. tularensis was not detected in the 38 common voles (microt ... | 2010 | 21142970 |
| ticks on humans in ankara, turkey. | in this study, a total of 5,094 ticks found on humans were examined in terms of species, development stage, gender, host features and seasonality for a year period. of these ticks 17 were argasid and 5,077 were ixodid. predominantly species of the ixodid genera hyalomma, dermacentor, rhipicephalus and haemaphysalis were found on humans in ankara (anatolia). most abundant were hyalomma nymphs (29.8%) and adults (28.2%). primary factors in terms of tick bite risk were region, habitat and season. | 2010 | 21153755 |
| development and biological characteristics of haemaphysalis longicornis (acari: ixodidae) under field conditions. | the development and biological characteristics of haemaphysalis longicornis were investigated under field conditions in xiaowutai national natural reserve area, north china. unfed larvae, nymphs and adults were fed on rabbits and exposed to daylight. three free-living stages were allowed to develop in field plot selected in a tick natural habitat. the host seeking behavior and seasonal occurrence were observed. haemaphysalis longicornis were active from mid march to mid october. the premoult per ... | 2010 | 21153756 |
| first survey on hard ticks (ixodidae) collected from humans in romania: possible risks for tick-borne diseases. | the importance of studies on the diversity of ticks attacking humans resides mostly in the relatively highly-specific tick-pathogen associations. human tick bites are commonly reported worldwide but removal of ticks from patients is rarely followed by specific identification of the ticks, leaving to some degree of hazard the preventive treatment of possible associated diseases. a total number of 308 ticks were collected between april and june 2010 from 275 human patients who voluntarily presente ... | 2010 | 21161719 |
| bacterial endosymbiont localization in hyalesthes obsoletus, the insect vector of bois noir in vitis vinifera. | one emerging disease of grapevine in europe is bois noir (bn), a phytoplasmosis caused by "candidatus phytoplasma solani" and spread in vineyards by the planthopper hyalesthes obsoletus (hemiptera: cixiidae). here we present the first full characterization of the bacterial community of this important disease vector collected from bn-contaminated areas in piedmont, italy. length heterogeneity pcr and denaturing gradient gel electrophoresis analysis targeting the 16s rrna gene revealed the presenc ... | 2010 | 21183640 |
| discrimination between haemaphysalis longicornis and h. qinghaiensis based on the partial 16s rdna and the second internal transcribed spacer (its-2). | in the present study, two hard tick species, haemaphysalis longicornis and h. qinghaiensis from north-western china were characterized genetically by the second internal transcribed spacer (its-2) of nuclear ribosomal dna and partial 16s rdna. based on a fragment within the hypervariable region of 16s rdna with the length of approximately 453 bp, the phylogenetic trees were constructed by neighbor-joining and maximum-parsimony methods. the results indicated that the phylogenetic status of h. qin ... | 2011 | 21225446 |
| ixodid ticks on domestic dogs in the northern cape province of south africa and in namibia. | the objective of this study was to determine the species composition of ixodid ticks infesting domestic dogs in the northwestern region of the northern cape province of south africa and in namibia. ticks were collected from february 2008 to january 2009 from dogs presented for a variety of reasons at a veterinary clinic in the northern cape province and at 3 clinics in namibia. the ticks collected at each place were pooled separately for each month at each locality. eleven ixodid tick species we ... | 2010 | 21247023 |
| detection of rickettsia and a novel haemaphysalis shimoga symbiont bacterium in ticks in thailand. | in this study, we identified two haemaphysalis species present at the khao yai national park in thailand and investigated the presence of rickettsia in these ticks. a total of 166 haemaphysalis specimens were collected randomly under leaves along visitor paths at five locations in the park. male and female adults of two different haemaphysalis species, h. shimoga and h. lagrangei, were identified. polymerase chain reaction (pcr) analysis revealed rickettsia bacteria in these two haemaphysalis sp ... | 2011 | 21318277 |