| detection of spotted fever group rickettsiae in ticks from zhejiang province, china. | tick species distribution and prevalence of spotted fever group rickettsiae (sfgr) in ticks were investigated in zhejiang province, china in 2010 and 2011. pcr was used to detect sfgr and positive amplicons were sequenced, compared to published sequences and phylogenic analysis was performed using mega 4.0. a total of 292 adult ticks of ten species were captured and 7.5 % (22/292) of the ticks were pcr-positive for sfg rickettsia. the pcr-positive rates were 5.5 % (6/110) for haemaphysalis longi ... | 2015 | 25633265 |
| prevalence of borrelia burgdorferi sensu lato in ticks from eastern china. | to explore the tick distribution and prevalence of borrelia in zhejiang province, we performed a survey in nine sites. a total of 447 adult ticks of 11 species were captured and the dominant tick species were haemaphysalis longicornis and ixodes sinensis and the abundance of tick species in different areas varied significantly. overall, 4.70% of the ticks were polymerase chain reaction (pcr) positive for borrelia. the average pcr positive rates were 5.19% for h. longicornis, 3.45% for amblyomma ... | 2015 | 25548382 |
| an immunosuppressant peptide from the hard tick amblyomma variegatum. | ixodid ticks are well known for spreading transmitted tick-borne pathogens while being attached to their hosts for almost 1-2 weeks to obtain blood meals. thus, they must secrete many immunosuppressant factors to combat the hosts' immune system. in the present work, we investigated an immunosuppressant peptide of the hard tick amblyomma variegatum. this peptide, named amregulin, is composed of 40 residues with an amino acid sequence of hlhmhgngatqvfkprlvlkcpnaaqliqpgklqrqlllq. a cdna of the prec ... | 2016 | 27153086 |
| the salivary secretome of the biting midge, culicoides sonorensis. | culicoides biting midges (diptera: ceratopogonidae) are hematophagous insects with over 1400 species distributed throughout the world. many of these species are of particular agricultural importance as primary vectors of bluetongue and schmallenberg viruses, yet little is known about culicoides genomics and proteomics. detailed studies of members from other blood-feeding dipteran families, including those of mosquito (culicidae) and black fly (simuliidae), have shown that protein components with ... | 2014 | 24949243 |
| rickettsia raoultii in haemaphysalis erinacei from marbled polecats, china-kazakhstan border. | we found rickettsia raoultii dna in 2 out of 32 (6.25 %) haemaphysalis erinacei ticks. result showed that the sequences of five genes (17-kda, glta, ompa, rrs, and ompb) were 100 % identity with that of r. raoultii in genbank. this study is the first report on the presence of r. raoultii in h. erinacei from wild marbled polecat, vormela peregusna. our findings suggest that h. erinacei parasitizing wild marbled polecat may serve as reservoir and carriers for r. raoultii in areas around the china- ... | 2015 | 26383238 |
| unprecedented genomic diversity of rna viruses in arthropods reveals the ancestry of negative-sense rna viruses. | although arthropods are important viral vectors, the biodiversity of arthropod viruses, as well as the role that arthropods have played in viral origins and evolution, is unclear. through rna sequencing of 70 arthropod species we discovered 112 novel viruses that appear to be ancestral to much of the documented genetic diversity of negative-sense rna viruses, a number of which are also present as endogenous genomic copies. with this greatly enriched diversity we revealed that arthropods contain ... | 2015 | 25633976 |
| molecular survey of anaplasma species in small ruminants reveals the presence of novel strains closely related to a. phagocytophilum in tunisia. | a survey of anaplasma species in small ruminants is still lacking in north african countries. in this study, the presence of a. phagocytophilum, a. phagocytophilum-related species, and a. ovis was investigated in a total of 563 healthy small ruminants (303 goats and 260 sheep), from 25 randomly selected flocks sampled in tunisia. anaplasma spp. and a. ovis overall infection rates were 95.0% and 93.8% in sheep and 69.6% and 65.3% in goats, respectively. a. phagocytophilum was not detected in any ... | 2015 | 26394065 |
| morphometric study on male specimens of hyalomma anatolicum (acari: ixodidae) in west of iran. | hyalomma anatolicum is the well-known hard tick, which is one of the most important livestock and human pathogens vector, wide range in host and distributed in all over the hyalomma geographic fauna as well as in iran. taxonomy of the hyalomma ssp. is debatable whereas their identification is a problematic work. the reasons for this claim is time consuming delpy's researches in iran also schulze school, feldman-muhsam and the russian tick workers. we would like to understand morphometric variati ... | 2011 | 22808415 |
| distribution of ticks (acari: ixodidae) infesting domestic ruminants in mountainous areas of golestan province, iran. | to determine the prevalence of ticks on cattle in the mountainous areas of golestan province and their geographical distribution. | 0 | 25183090 |
| a multiplex pcr/ldr assay for the simultaneous identification of category a infectious pathogens: agents of viral hemorrhagic fever and variola virus. | cdc designated category a infectious agents pose a major risk to national security and require special action for public health preparedness. they include viruses that cause viral hemorrhagic fever (vhf) syndrome as well as variola virus, the agent of smallpox. vhf is characterized by hemorrhage and fever with multi-organ failure leading to high morbidity and mortality. smallpox, a prior scourge, has been eradicated for decades, making it a particularly serious threat if released nefariously in ... | 2015 | 26381398 |
| coevolutionary analyses of the relationships between piroplasmids and their hard tick hosts. | host-parasite coevolution is a key driver of biological diversity. to examine the evolutionary relationships between piroplasmids and their hard tick hosts, we calculated the molecular clock and conducted phylogenetic analyses of both groups. based on our results, we conclude that the divergence time of piroplasmids (ā¼56 mya) is later than divergence time of their hard tick hosts (ā¼86 mya). from analyses of the evolution of both piroplasmid and vector lineages and their association, we know that ... | 2013 | 24101988 |
| prevalence of tick infestation in dromedary camels (camelus dromedarius) brought for slaughter in mashhad abattoir, iran. | this study was carried out to investigate the prevalence of tick infestation and identify tick species that parasitize dromedary camels. since april 2012 through march 2013, a total of 400 camels that brought for slaughter in mashhad abattoir were examined for tick infestation. out of the total 400 camels examined, 237 were infested and annual prevalence of tick infestation 59.25 % (95 % ci 54-64) was calculated. the higher prevalence rates were found in the summer and spring, especially the sum ... | 2013 | 26345051 |
| anaplasma phagocytophilum in sheep and goats in central and southeastern china. | anaplasma phagocytophilum is wide spread throughout the world and impacts both human and animal health. several distinct ecological clusters and ecotypes of the agent have been established on the basis of various genetic loci. however, information on the genetic variability of a. phagocytophilum isolates in china represents a gap in knowledge. the objective of this study was to determine the prevalence and genetic characterization of a. phagocytophilum in small ruminants in central and southeast ... | 2016 | 27871295 |
| specific histamine binding activity of a new lipocalin from hyalomma asiaticum (ixodidae) and therapeutic effects on allergic asthma in mice. | lipocalin proteins are secreted by tick salivary glands as an important strategy to interfere with the immune response of hosts. a large number of lipocalins are secreted, but the functions of most of these proteins are unclear. here, we report a new lipocalin protein with particular histamine binding capacity, which was isolated from the salivary glands of the tick hyalomma asiaticum. | 2016 | 27639693 |
| kampinos national park: a risk area for spotted fever group rickettsioses, central poland? | ixodid ticks are important vectors of a variety of bacterial and protozoan pathogens which cause infections in humans. in this study, altogether 1041 questing ixodes ricinus (n = 305) and dermacentor reticulatus ticks (n = 736), sympatrically occurring in kampinos national park (kpn), central-east poland, were analyzed by pcr for rickettsia species. overall, the pathogen prevalence in ticks was 27.5 % for i. ricinus and 42.8 % for d. reticulatus. sequencing analysis showed that the first tick sp ... | 2016 | 27631765 |
| evaluation of different nested pcrs for detection of anaplasma phagocytophilum in ruminants and ticks. | anaplasma phagocytophilum is a causative agent of granulocytic anaplasmosis in mammals, which has a broad geographical distribution and a high degree of clinical diversity. currently, numerous pcr assays have been developed and used for the detection of a. phagocytophilum in various specimens. however, their performance varies. the aim of this study was to evaluate the performance of five nested pcr assays by detection of 363 ruminant and tick samples, and to select the most appropriate methods ... | 2016 | 26911835 |
| complete genome sequences of two crimean-congo hemorrhagic fever viruses isolated in china. | here, we report the complete genome sequences of two crimean-congo hemorrhagic fever virus (cchfv) strains, 79121m18 and yl04057, isolated in xinjiang, china. sequence analysis showed that they represent a genotype of cchfv that has not been reported before. | 2013 | 23908296 |
| [taxonomy of previously unclassified tamdy virus (tamv) (bunyaviridae, nairovirus) isolated from the hyalomma asiaticum asiaticum schülce et schlottke, 1929 (ixodidae, hyalomminae) in the middle east and transcaucasia]. | complete genome sequencing of three tamdy (tamv) virus strains was carried out. the prototype strain tamv/leiv-1308uz was isolated for the very first time from the hyalomma asiaticum asiaticum schülce et schlottke, 1929 (ixodidae, hyalomminae) collected in the august 1971 from sheep in the arid area near namdybulak town (41 degrees 36' n, 64 degrees 39' e) in the tamdinsky district of the bukhara region (uzbekistan). tamv was revealed to be a prototype member of the new phylogenetic group within ... | 2016 | 25069280 |
| [genetic characterization of the wad medani virus (wmv) (reoviridae, orbivirus), isolated from the ticks hyalomma asiaticum schulze et schlottke, 1930 (ixodidae: hyalomminae) in turkmenistan, kazakhstan, and armenia and from the ticks h. anatolicum koch, 1844 in tajikistan]. | near full-genome sequence of the wad medani virus (wmv) (strain leiv-8066tur) (orbivirus, reoviridae) isolated from the ticks hyalomma asiaticum schulze et schlottke, 1929, collected from sheep in baharly district in turkmenistan, was determined using next generation sequencing approach. the similarity of the rna-dependent rna-polymerase (pol, vp1) amino acid sequence between wmv and the kemerovo group orbiviruses (kemv), as well as of the baku virus (bakv), was 64%. the similarity of the conser ... | 2016 | 25549464 |
| distribution and molecular characteristics of rickettsiae found in ticks across central mongolia. | little is known regarding tick-borne diseases in mongolia, despite having 26% of the population still living nomadic pastoral lifestyles. a total of 1497 adult unfed ticks: 261 ixodes persulcatus, 795 dermacentor nuttalli, and 441 hyalomma asiaticum, were collected from three ecologically distinct regions in central mongolia. tick pools (nā=ā299) containing ~5 ticks each, were tested for rickettsia and tick-borne encephalitis virus (tbev) using nested polymerase chain reaction, reverse transcrip ... | 2017 | 28153052 |
| survey on infection rate, vectors and molecular identification of theileria annulata in cattle from north west, iran. | tropical theileriosis is a progressive bovine lymphoproliferative disease caused by the intracellular protozoan parasite theileria annulata. in this study 138 blood samples and 289 ticks were collected and examined from cattle that belonged to 10 randomly selected flocks. the tbs-s/tbs-a primer set was used for pcr amplification of theileria spp. and the ta-s/tbs-a specific primer set was used in semi-nested pcr technique for detection of t. annulata. blood smears of each case were examined by g ... | 2016 | 27605839 |
| pcr-based detection of theileria annulata in hyalomma asiaticum ticks in northwestern china. | this study aimed to detect theileria annulata infection using polymerase chain reaction (pcr) amplification in hyalomma asiaticum ticks. sequence analysis showed that the 28 analyzed sequences obtained from 81 h. asiaticum ticks had an identical length and sequence which were closely related to that of t. annulata. this study is the first to report on the presence of t. annulata in h. asiaticum ticks in china. | 2014 | 24252264 |
| prevalence of ixodid ticks on cattle, sheep and goats in ilam county, ilam province, iran. | this survey was performed to find out the infestation rate of ixodidae ticks in domestic ruminants in ilam county during 21 march 2009 to 23 august 2009. sampling was performed in 25 villages and 15 animal farm from different areas of this county. a total of 1,316 ticks were collected from 416 cattle, 208 sheep and 147 goats. the overall prevalence of ticks was recorded: 43, 23.5, and 49/6 % in cattle, sheep, and goats respectively. the number of ticks that collected from cattle, sheep, and goat ... | 2013 | 25698857 |
| [the manifestation of sexual dimorphism in the preimago phases of 2 species of the genus hyalomma (ixodoidea, ixodidae)]. | experiments on laboratory cultures of hyalomma asiaticum and h. anatolicum have shown that at the nymphal phase sexual dimorphism manifests itself in statistically reliable differences between general sizes and mass of the body of male and female individuals. larger nymphs moult mostly into females, small ones mostly into males. reliable differences have been noted in the sizes of scutum, gnathosoma and its appendages in male and female nymphs of both species. at the larval phase sexual dimorphi ... | 2007 | 3357700 |
| [ultrastructure of the cheliceral sensilla of the ixodid tick hyalomma asiaticum]. | | 2007 | 3438099 |
| [ultrastructural characteristics of the hemocytes of the ixodid tick hyalomma asiaticum (ixodidae)]. | | 2007 | 6856326 |
| [ultrastructure of the epithelium of the midgut in nymphs of hyalomma asiaticum (acarina, ixodidae) ticks during feeding]. | the midgut epithelium of h. asiaticum nymphs was studied by means of electron microscopy. it has been shown that during feeding the midgut epithelium of the above nymphs consists of three types of cells: reserve, secretory and digestive ones. there have been revealed two types of the digestive cells. the cells of the first type are capable for two forms of blood endocytosis: phagocytosis and pinocytosis. during feeding in these cells takes place fast intracellular digestion. this type of cells d ... | 2007 | 958714 |
| [ultrafine structure of the integument of the tick hyalomma asiaticum p. sch. et e. schl. in starvation and feeding]. | integument fine structure of h. asiaticum nymphs during their feeding and starvation has been studied. in hungry nymphs hypoderma has an ultrastructure typical for hypodermal cells of arthropods in the intermoulting period and is characterized by a poor development of granular endoplasmic reticulum, small number of mitochondrial and absence of golgi complexes. the apical surface of the cells is covered with short irregularly scattered microvilli. the cuticle consists of the procuticle, which has ... | 2007 | 1187172 |
| tick infestation rate of sheep and their distribution in abdanan county, ilam province, iran, 2007-2008. | ticks are hematophagous arthropod belonging to the class of arachnids. ticks are also one of the major vectors of pathogens to animal and human. this study was conducted to determine tick infestation rate of sheep in abdanan during 2007-2008. | 2010 | 22808401 |
| morphological, biological and molecular characteristics of bisexual and parthenogenetic haemaphysalis longicornis. | the reproductive mechanism of haemaphysalis longicornis is quite different from many other animal species. in this article, several characteristics of parthenogenetic and bisexual populations of h. longicornis were analyzed, including some important micro-structures, synchronized life cycle feature and sequences of mitochondrial 16s rrna gene. the results suggested even though many observations of the two populations were similar to each other, some important differences also existed. the genita ... | 2012 | 22560314 |
| [electron microscopic study of the malpighian tubules of the tick hyalomma asiaticum p. sch. et e. schl. i. empty females]. | | 2007 | 4590725 |
| [water balance and behavior of hyalomma asiaticum in the desert]. | | 2009 | 13686205 |
| temporal and spatial distribution and species diversity of hard ticks (acari: ixodidae) in the eastern region of caspian sea. | ticks are important parasites because of their voracious blood-feeding activity, and being as vectors for various agents of diseases in both human and livestock. this study was conducted in a monthly schedule from october 2014 to december 2015, at 45 study sites in three regions bordering the caspian sea, according to the topography including hillside, plain and coastal areas in collecting ticks from the body of sheep. alfa and beta biodiversity indices were calculated and compared between the t ... | 2016 | 27519473 |
| [the impact of electromagnetic radiation at microwave frequency (9.8 hhz)on the embryonic and postembryonic development of the tick hyalomma asiaticum (acarina, ixodidae)]. | low-power (20 microw/cm2) microwave-modulated radiation at a carrier frequency of 9.8 hhz is shown to affect the course and specific features of ontogenesis of the ick h. asiaticum. the actin of microwave radiation on the development of h. asiaticum substantially depends on the frequency of microwave modulation of a signal and on the temperatures of an experiment. when the temperature is 22 degrees c, there is a significant suppression of development of fed larvae and nymphs after exposure to mi ... | 2009 | 16416556 |
| [first delection of borrelia burgdorferi sensu stricto genotype from hyalomma asiaticum in karamay, xinjiang uygur autonomous region of china]. | | 2015 | 26281627 |
| [isolation of borrelia burgdorferi in ixodes from four counties, in north xinjiang]. | to identify ticks and determine the borrelia (b.) burgdorferi genotype from four counties of northern xinjiang. | 2014 | 24831623 |
| [taxonomic status of the chim virus (chimv) (bunyaviridae, nairovirus, qalyub group) isolated from the ixodidae and argasidae ticks collected in the great gerbil (rhombomys opimus lichtenstein, 1823) (muridae, gerbillinae) burrows in uzbekistan and kazakhstan]. | full-length genome of the chim virus (chimv) (strain leiv-858uz) was sequenced using the next-generation sequencing approach (id genbank: kf801656). the chimv/leiv-858uz was isolated from the ornithodoros tartakovskyi olenev, 1931 ticks collected in the great gerbil (rhombomys opimus lichtenstein, 1823) burrow in uzbekistan near chim town (kashkadarinsky region) in july of 1971. later, four more chimv strains were isolated from the o. tartakovskyi, o. papillipes birula, 1895, rhipicephalus turan ... | 2016 | 25335414 |
| a new strain of crimean-congo hemorrhagic fever virus isolated from xinjiang, china. | crimean-congo hemorrhagic fever virus (cchfv) is a highly pathogenic tick-borne virus with a fatality rate of up to 50% in humans. cchfv is widely distributed in countries around the world. outbreaks of cchfv infection in humans have occurred in prior years in xinjiang province, china. epidemiological surveys have detected cchfv rna in ticks and animals; however, few isolates were identified. in this study, we identified and isolated a new cchfv strain from hyalomma asiaticum asiaticum ticks col ... | 2017 | 28251517 |
| crimean-congo hemorrhagic fever virus clade iv (asia 1) in ticks of western iran. | crimean-congo hemorrhagic fever virus (cchfv) is transmitted through the bite of an infected tick, or by direct contact with cchfv-infected patients' blood or the products of infected livestock. in 2012, ticks were collected in eight regions of lorestan province, iran. in total, 434 ticks were collected. reverse transcriptase polymerase chain reaction was used for the detection of cchfv rna. of 434 ticks, 419 (96.6%) ticks were from the family ixodidae (hard ticks) and 15 (3.5%) ticks were from ... | 2015 | 26336221 |
| hard ticks (ixodidae) and crimean-congo hemorrhagic fever virus in south west of iran. | ticks are vectors of some important arthropod-borne diseases in both fields of veterinary and medicine, such as lyme, tularemia, rocky mountain spotted fever, and some types of encephalitis as well as crimean congo hemorrhagic fever (cchf). iran is known as one of the main foci of cchf in west of asia. this study was conducted in darrehshahr county because of the development of animal husbandry in this area to detect the fauna and viral infection of the hard ticks of livestock. a cross-sectional ... | 2015 | 25796025 |
| first phylogenetic analysis of a crimean-congo hemorrhagic fever virus genome in naturally infected rhipicephalus appendiculatus ticks (acari: ixodidae). | crimean-congo haemorrhagic fever (cchf) is a potentially fatal systemic viral disease in many parts of the world, including iran. the nationwide incidence of human cchf in endemic areas was 870 confirmed cases with 126 deaths (case fatality rate, cfr = 17.6 %) in the decade leading to 2012. the detection of the cchf virus (cchfv) genome in tick vectors is of fundamental importance for identifying these ticks as potential reservoirs of cchfv infection. from may to october 2013, following detectio ... | 2015 | 25742932 |
| [visual potentialities of the tick hyalomma asiaticum asiaticum (ixodidae)]. | ethological experiments with the desert tick hyalomma asiaticum asiaticum are conducted. it is shown that tick inhabiting open landscapes discovers his host using his eyes. since the eyes of this species have a poor resolving possibility, black objects with white strips drawn on it are less attractive for the tick. when the tick scans an area looking for host, the principal optical axis of his eyes is directed not higher than 20 degrees. in allows the tick to discover objects having angular size ... | 2008 | 16033221 |
| [the reaction of the tick hyalomma asiaticum (acarina, ixodidae) to 1- to 4-ghz microwaves]. | low-energy microwave radiation in the frequency range in question was found to exert a noticeable biological action on h. asiaticum. radiation delayed larval hatch by 3-20 days, increased the activity duration of newly moulted larvae by 17-24 days, reduces the survival of hungry larvae and nymphs by 4-10 days. the efficiency of the biological action of microwaves is enhanced by impairments in the natural developmental rhythm of the tick. | 2009 | 9026668 |
| oxygen consumption of engorged nymphs and unfed adults of hyalomma asiaticum ticks (acari: ixodidae) exposed to various photoperiods. | the oxygen consumption of engorged nymphs of hyalomma asiaticum was measured at various intervals after drop-off from mice hosts. duration of nymphal development to the emergence of adults was 25-32 days at 25 degrees c. the oxygen consumption was high immediately after completing the blood meal (193-248 mm3 g-1 h-1 but decreased significantly 18 days later (at 25 degrees c) to 45-65 mm3 g-1 h-1. it increased again before ecdysis (81-102 mm3 g-1 h-1, and also after ecdysis in freshly moulted adu ... | 1993 | 7628236 |
| [ultrastructural characteristics of the histopathologic changes at the site of attachment to the host's body of larvae of the ixodid tick hyalomma asiaticum]. | tissues of white mice in the place of the attachment of h. asiaticum larvae were examined by means of electron microscopy 2, 4, 24 and 72 hours after the attachment to the host. fine structure of the cement sheath, peculiarities of its connection with host's tissues, fine structure of derm at different feeding stages of the tick are studied. | 2007 | 2812858 |
| [ultrastructural study of the internal organs of ixodid ticks in the scanning electron microscope]. | the structure of the surfaces of midgut and salivary glands in hungry and engorged females of hyalomma asiaticum was studied by means of scanning electron microscopy. preparations were fixed in glutaraldehyde osmium and then dehydrated by the critical point method and gold or platinum coating different periods of fixation at room temperature or at 4 degrees c did not affect the condition of surface structures of gut and salivary glands. | 2007 | 3226779 |
| identification and anticoagulant activity of a novel kunitz-type protein ha11 from the salivary gland of the tick hyalomma asiaticum. | kunitz/bovine pancreatic trypsin inhibitor proteins are abundant in the salivary glands of ticks and perform multiple functions in blood feeding, including inhibiting blood coagulation, regulating host blood supply and disrupting host angiogenesis. in this study, we identified a novel gene designated ha11 (hyalomma asiaticum 11 kda protein) from the salivary gland of the tick h. asiaticum. ha11 is encoded by a gene with an open reading frame of 306 bp that is translated into a deduced 101 amino ... | 2017 | 28091958 |
| evaluation on infectivity of babesia microti to domestic animals and ticks outside the ixodes genus. | babesiosis caused by babesia microti parasite is an emerging tick borne zoonotic disease that was confirmed recently in china. to understand the epidemiology characteristics of this emerging disease, infectivity of b. microti to domestic animals and ticks outside the genus ixodes was evaluated in this study. different domestic animals, chick, pig, goat, dog and the reference host rat were experimentally inoculated with b. microti-infected erythrocytes and the parasite infection was monitored dai ... | 2017 | 29056929 |
| the efficacies of 5 insecticides against hard ticks hyalomma asiaticum, haemaphysalis longicornis and rhipicephalus sanguineus. | at present, chemical-based tick control strategies are still the most efficient and widely used methods in control of ticks and tick-borne diseases. in this study, the efficacies of lambda-cyhalothrin, beta-cypermethrin, emamectin benzoate, spirotetramat and hexaflumuron in vitro were evaluated against hyalomma asiaticum, haemaphysalis longicornis and rhipicephalus sanguineus that are widespread and able to transmit a variety of human and animal diseases in china. the results showed that the lc ... | 2015 | 26115939 |
| distribution and phylogeny of hyalomma ticks (acari: ixodidae) in turkey. | the genus hyalomma includes some of the most medically and veterinarily important tick species in the world. to clarify and identify the current distribution of the species of hyalomma, field studies were conducted in 65 localities in turkey and five localities in cyprus. additionally, using mitochondrial 12s and 16s ribosomal dna, specimens of hyalomma from turkey, h. excavatum from cyprus, h. marginatum from spain and italy were evaluated together with the available sequences obtained from gen ... | 2017 | 29177952 |
| the genus hyalomma. xi. redescription of all parasitic stages of h. (euhyalomma) asiaticum (acari: ixodidae) and notes on its biology. | the tick hyalomma (euhyalomma) asiaticum schulze & schlottke is provisionally considered to belong to the h. (e.) asiaticum group of closely related species. males of h. asiaticum can be distinguished from those of other species of the group by their long and very deep cervical grooves, long, narrow, straight adanal plates, long dorsal prolongation of the spiracular plates, dorsal posterior margin of the basis capituli deeply concave and angular, and unbroken ivory-coloured strip on the dorsal a ... | 2010 | 20383566 |
| prevalence of ixodid ticks on cattle and sheep northeast of iran. | a survey was carried out to investigate the prevalence of hard tick species (acari: ixodidae) on cattle and sheep north of iran. the aim of study was to determine the prevalence of hard ticks on cattle and sheep in the mountainous areas of golestan province and their geographical distribution. a total of 26 ticks were collected from 22 infested cattle and 26 ticks were collected from 12 infested sheep during activating seasons of ticks in 2013-2014. the species collected from cattle and sheep we ... | 2016 | 27605782 |
| cloning and expression of the 4d8 gene from hyalomma asiaticum tick. | hyalomma asiaticum tick, an important ectozoic parasite causes tickle, pain, anemia, weight loss, and paralysis in its hosts, which include humans, cattle, sheep, horses, camels, and hares. the 4d8 gene can be a potential vaccine candidate antigen for h. asiaticum. in the present study, we cloned and expressed the 4d8 gene of h. asiaticum from xinjiang province. primers were designed according to the h. asiaticum tick 4d8 gene sequence available in genbank. the gene was amplified by reverse tran ... | 2016 | 27323189 |
| [electron microscopic study of intracellular digestion in intestinal cells of the ixodid tick hyalomma asiaticum. i. formation of primary and secondary lysosomes]. | the formation of primary and secondary lysosomes in digestive cells of midgut of the tick h. asiaticum was investigated using ultracytochemical methods for acid phosphatase. this enzyme is synthesized in the rough endoplasmic reticulum cisternae to be concentrated in the golgi complex. vesicles 0.1-0.15 mum in diameter filled with the enzyme are propagated from the distal golgi cisternae which are primary lysosomes. secondary lysosomes are produced in result of fusion of primary lysosomes with h ... | 1975 | 169613 |
| [electrophysiological reactions of the neurons of haller's organ of the tick hyalomma asiaticum p. sch. et e. schl. to smell]. | | 2008 | 4836617 |
| ixodidae ticks in cattle and sheep in sistan and baluchestan province (iran). | this survey was conducted to investigate the presence and abundance of hard tick species (acari: ixodidae) on cattle and sheep in sistan and baluchestan province (iran). between 2010 and 2011, a total of 1,403 ticks was collected from 332 infested cattle and 1,480 ticks were collected from 602 infested sheep during the seasons of tick activity. the species collected from cattle were hyalomma marginatum (46.04%), hyalomma excavatum (25.51%), hyalomma anatolicum (10.33%), hyalomma asiaticum (6.34% ... | 2014 | 24715595 |