| selection and use of autochthonous mixed starter for lactic acid fermentation of carrots, french beans or marrows. | strains of leuconostoc mesenteroides, lactobacillus plantarum, weissella soli/weissella koreensis, enterococcus faecalis, pediococcus pentosaceus and lactobacillus fermentum were identified from raw carrots, french beans and marrows by partial 16s rrna gene sequence. l. plantarum m1, leuc. mesenteroides c1 and p. pentosaceus f4 were selected based on the rates of growth and acidification in vegetable juice media, and used as the autochthonous mixed starter for the fermentation of carrots, french ... | 2008 | 18710789 |
| use of lactobacillus strains to start cassava fermentations for gari production. | two lactobacillus strains, lactobacillus plantarum bfe 6710 and lactobacillus fermentum bfe 6620, were used to start cassava fermentations in a pilot study under field production conditions in kenya, to determine their potential to establish themselves as predominant lactobacilli during the fermentation. predominant strains from three fermentations were isolated throughout the 48 h fermentation period. the use of these strains in high numbers clearly resulted in 1 to 2 log higher lactic acid bac ... | 2008 | 18834642 |
| microbial diversity of traditional vietnamese alcohol fermentation starters (banh men) as determined by pcr-mediated dgge. | the diversity of fungi and bacteria associated with traditional vietnamese alcohol fermentation starters (banh men) was investigated by pcr-mediated dgge. from 52 starter samples, 13 species of fungi (including yeasts) and 23 species of bacteria were identified. the fungal composition of the starters was consistent with little variation among samples. it consisted of amylase producers (rhizopus oryzae, r. microsporus, absidia corymbifera, amylomyces sp., saccharomycopsis fibuligera), ethanol pro ... | 2008 | 18838186 |
| characterization of exopolysaccharide (eps) produced by weissella hellenica skkimchi3 isolated from kimchi. | weissella hellenica skkimchi3 produces the higher exopolysaccharide (eps) on sucrose than lactose, glucose, and fructose at ph 5 and 20 degrees c. sucrose was exclusively used to cultivate skkimchi3 in all experiments base on the eps production tests. the molecular mass of eps, as determined by gel permeation chroma-tography, was 203,000. (1)h and (13)c nmr analysis indicated that the identity of eps may be a glucan. when eps, starch, and cellulose was treated with a-amylase, glucoamylase, gluco ... | 2008 | 18974955 |
| effect of autochthonous lactic acid bacteria starters on health-promoting and sensory properties of tomato juices. | strains of lactobacillus plantarum, weissella cibaria/confusa, lactobacillus brevis, pediococcus pentosaceous, lactobacillus sp. and enterococcus faecium/faecalis were identified from raw tomatoes by biolog system, partial 16s rrna gene sequence and subjected to typing by random amplified polymorphic dna-polymerase chain reaction (rapd-pcr) analysis. ten autochthonous strains were singly used to ferment tomato juice (tj) via a protocol which included fermentation at 25 degrees c for 17 h and fur ... | 2009 | 19028404 |
| screening of surface properties and antagonistic substances production by lactic acid bacteria isolated from the mammary gland of healthy and mastitic cows. | bovine mastitis (bm) is a costly disease in dairy cattle production. the prevention and treatment of mastitis is performed by applying antimicrobial products that negatively affect milk quality. in the last years, the use of probiotic microorganisms to prevent infections in humans and animals has being aggressively studied. samples from teat canal and milk (foremilk and stripping) were taken from healthy and mastitic mammary quarters. a screening of the surface properties and antagonistic substa ... | 2009 | 19041199 |
| in vitro fermentation of carbohydrates by porcine faecal inocula and their influence on salmonella typhimurium growth in batch culture systems. | the aim of this study was to evaluate in vitro the influence of fermentable carbohydrates on the activity of porcine microbiota and survival of salmonella typhimurium in a batch culture system simulating the porcine hindgut. the carbohydrates tested were xylooligosaccharides, a mixture of fructooligosaccharides/inulin (fin), fructooligosaccharides (fos), gentiooligosaccharides (geo) and lactulose (lac). these ingredients stimulated the growth of selected bifidobacterium and lactobacillus species ... | 2008 | 19049655 |
| a genus-specific pcr method for differentiation between leuconostoc and weissella and its application in identification of heterofermentative lactic acid bacteria from coffee fermentation. | a genus-specific pcr analysis method was developed for a rapid and reliable differentiation between the two heterofermentative lactic acid bacteria genera leuconostoc and weissella. primer sets specific for target regions of the 16s rrna genes were designed and the specificity of the pcr was evaluated using the type strains of 13 species of leuconostoc and 11 species of weissella. in addition, the newly developed genus-specific pcr analysis was applied to characterize 72 lactic acid bacteria (la ... | 2008 | 18657111 |
| taxonomic structure and monitoring of the dominant population of lactic acid bacteria during wheat flour sourdough type i propagation using lactobacillus sanfranciscensis starters. | the structure and stability of the dominant lactic acid bacterium population were assessed during wheat flour sourdough type i propagation by using singly nine strains of lactobacillus sanfranciscensis. under back-slopping propagation with wheat flour type 0 f114, cell numbers of presumptive lactic acid bacteria varied slightly between and within starters. as determined by randomly amplified polymorphic dna-pcr and restriction endonuclease analysis-pulsed-field gel electrophoresis analyses, only ... | 2009 | 19088320 |
| lactic acid bacteria from fresh fruit and vegetables as biocontrol agents of phytopathogenic bacteria and fungi. | this study evaluated the efficacy of lactic acid bacteria (lab) isolated from fresh fruits and vegetables as biocontrol agents against the phytopathogenic and spoilage bacteria and fungi, xanthomonas campestris, erwinia carotovora, penicillium expansum, monilinia laxa, and botrytis cinerea. the antagonistic activity of 496 lab strains was tested in vitro and all tested microorganisms except p. expansum were inhibited by at least one isolate. the 496 isolates were also analyzed for the inhibition ... | 2008 | 19204894 |
| use of autochthonous starters to ferment red and yellow peppers (capsicum annum l.) to be stored at room temperature. | strains of lactobacillus curvatus, leuconostoc mesenteroides, lactobacillus plantarum and weissella confusa were identified from raw red and yellow peppers (ryps) by partial 16s rrna gene sequence and subjected to typing by random amplified polymorphic dna-polymerase chain reaction (rapd-pcr) analysis. l. plantarum pe21, l. curvatus pe4 and w. confusa pe36 were selected based on the kinetics of growth and acidification, and used as the autochthonous mixed starter for the fermentation of ryps. a ... | 2009 | 19217182 |
| molecular characterization and expression analysis of the glucansucrase dsrwc from weissella cibaria synthesizing a alpha(1-->6) glucan. | weissella cibaria isolated from human saliva produces a soluble glucan that predominantly has alpha-1,6-glucosidic type linkages. using degenerated primers that were selected based on the amino acid sequences of conserved regions from known glucansucrases, a single 2.7-kb fragment was isolated. in subsequent steps, a 4969-bp product was obtained using inverse pcr. the coding region for the glucansucrase gene (dsrwc) consisted of a 4419-bp orf that encoded a 1472-amino acid protein with a calcula ... | 2009 | 19222580 |
| antifungal activity of strains of lactic acid bacteria isolated from a semolina ecosystem against penicillium roqueforti, aspergillus niger and endomyces fibuliger contaminating bakery products. | thirty samples of italian durum wheat semolina and whole durum wheat semolina, generally used for the production of southern italy's traditional breads, were subjected to microbiological analysis in order to explore their lactic acid bacteria (lab) diversity and to find strains with antifungal activity. a total of 125 presumptive lab isolates (gram-positive and catalase-negative) were characterized by repetitive extragenic palindromic-pcr (rep-pcr) and sequence analysis of the 16s rrna gene, lea ... | 2009 | 19243908 |
| impact of polyunsaturated fatty acid degradation on survival and acidification activity of freeze-dried weissella paramesenteroides lc11 during storage. | the impact of polyunsaturated fatty acid (pufa) degradation on the survival and acidification activity of freeze-dried weissella paramesenteroides lc11 was investigated over 90-days storage at 4 degrees c or 20 degrees c in vacuum-sealed aluminium foil or glass tubes with two water activities (a(w)=0.11 or 0.23). colony counts, acidification activity (% lactic acid/g), linoleic/palmitic (18:2/16:0) or linolenic/palmitic (18:3/16:0) ratio by gas chromatography and 18:2 or 18:3 oxylipins by revers ... | 2008 | 18461316 |
| nmr spectroscopic analysis of exopolysaccharides produced by leuconostoc citreum and weissella confusa. | dextrans are the main exopolysaccharides produced by leuconostoc species. other dextran-producing lactic acid bacteria include streptococci, lactobacilli, and weissella species. commercial production and structural analysis has focused mainly on dextrans from leuconostoc species, particularly on leuconostoc mesenteroides strains. in this study, we used nmr spectroscopy techniques to analyze the structures of dextrans produced by leuconostoc citreum e497 and weissella confusa e392. the dextrans w ... | 2008 | 18452899 |
| first description of a novel weissella species as an opportunistic pathogen for rainbow trout oncorhynchus mykiss (walbaum) in china. | six strains of gram-positive, catalase-negative, non-motile, irregular short rod-shaped weissella bacteria, with width and length of 0.5-0.6 and 1.2-2.7microm were isolated from diseased rainbow trout oncorhynchus mykiss (walbaum) in winter of 2007 at a commercial fishery in jingmen, hubei province, china. the diseased rainbow trout exhibited hemorrhage in eyes, anal region, intestine and abdomen wall, petechia of liver, some fish with hydrocele in stomach. six isolates had identical biochemical ... | 2009 | 19321272 |
| the influence of different preservation methods on spoilage bacteria populations inoculated in morcilla de burgos during anaerobic cold storage. | blood sausage is a widely consumed traditional product that would benefit from an extended shelf life. the two main spoilage bacteria in vacuum-packaged morcilla de burgos are weissella viridescens and leuconostoc mesenteroides. this study examines the way in which three preservation treatments--organic acid salts (oas), high-pressure processing (hpp) and pasteurization--influence these bacterial populations and their spoilage behaviour. hpp and pasteurization treatments were found to inhibit gr ... | 2009 | 19411125 |
| pyrosequencing of tagged 16s rrna gene amplicons for rapid deciphering of the microbiomes of fermented foods such as pearl millet slurries. | pearl millet slurries, mixed with groundnuts or not, were chosen as a model to investigate the feasibility of obtaining a rapid overview of community structure and population dynamics of fermented foods using pyrosequencing of tagged 16s rrna gene amplicons. from 14 fermented samples collected either in a traditional small-scale processing unit in burkina faso or at laboratory scale, 137,469 sequences of bacterial 16s rrna gene amplicons were characterized. except for a few proteobacteria, almos ... | 2009 | 19411407 |
| sodium acetate enhances hydrogen peroxide production in weissella cibaria. | to investigate hydrogen peroxide production by lactic acid bacteria (lab) and to determine the key factors involved. | 2009 | 19413761 |
| modelling the growth of weissella cibaria as a function of fermentation conditions. | to investigate the effect of ph, water activity (a(w)) and temperature on the growth of weissella cibaria dbpz1006, a lactic acid bacterium isolated from sourdoughs. | 2009 | 19426261 |
| bacterial associates of arboreal ants and their putative functions in an obligate ant-plant mutualism. | bacterial communities are highly diverse and have great ecological importance. in the present study, we used an in silico analysis of terminal restriction fragments (trf) to characterize the bacterial community of the plant ant pseudomyrmex ferrugineus. this species is an obligate inhabitant of acacia myrmecophytes and feeds exclusively on plant-derived food sources. ants are the dominant insect group in tropical rain forests. associations of ants with microbes, which contribute particularly to ... | 2009 | 19447959 |
| identification and evaluation of the probiotic potential of lactobacilli isolated from canine milk. | canine milk protects puppies against infectious diseases through a variety of mechanisms. in this study, the presence of potentially probiotic lactic acid bacteria grown on mrs-cys agar plates from milk of nine bitches was investigated. the gram positive catalase negative bacilli identified in this study belonged to four lactobacillus species (lactobacillus reuteri, lactobacillus fermentum, lactobacillus murinus, lactobacillus animalis), as well as one isolate that was identified as weissella vi ... | 2010 | 19451012 |
| weissella halotolerans w22 combines arginine deiminase and ornithine decarboxylation pathways and converts arginine to putrescine. | to demonstrate that the meat food strain weissella halotolerans combines an ornithine decarboxylation pathway and an arginine deiminase (adi) pathway and is able to produce putrescine, a biogenic amine. evidence is shown that these two pathways produce a proton motive force (pmf). | 2009 | 19486212 |
| the microbiota of lafun, an african traditional cassava food product. | lafun is a fermented cassava food product consumed in parts of west africa. in the present work the microorganisms (aerobic bacteria (ab), lactic acid bacteria (lab) and yeasts) associated with the fermentation of lafun under traditional conditions have for the first time been studied using a combination of pheno- and genotypic methods. during lafun fermentation the ab count ranged from 6-7 log(10) cfu/g at the beginning to 9 log(10) cfu/g at the end. similarly, the number of lab increased from ... | 2009 | 19493582 |
| inhibition of uropathogens by lactic acid bacteria isolated from dairy foods and cow's intestine in western nigeria. | a total of 96 lactic acid bacteria (lab) were isolated from african indigenous fermented products and cow's intestines to study their inhibitory capability against multi-drug-resistant uropathogens. escherichia coli accounted for approximately 45% of isolated uropathogens, followed by staphylococcus spp. (20%). the gram negative uropathogens were highly resistant to quinolones, co-trimoxazole, teicoplanin and some beta-lactams, while the staphylococcus spp. showed high resistance to aminoglycosi ... | 2009 | 19529917 |
| spoilage of blood sausages morcilla de burgos treated with high hydrostatic pressure. | in this study, the microbial ecology of the blood sausage morcilla de burgos, subjected to high hydrostatic pressure treatment (hpp), was studied by culture-dependent and -independent methods. morcilla de burgos is the most traditional and famous blood sausage in spain. the producers are interested in extending its shelf-life in order to expand their market and to reduce losses attributed to spoilage. sausage batter prior to stuffing and blood sausages hpp treated or not (control) were analyzed ... | 2008 | 18367280 |
| [lactic acid bacteria diversity in fermented cabbage estimated by culture-dependent and-independent methods]. | to study the diversity of lactic acid bacteria (lab) and dominant lab in fermented cabbage. | 2009 | 19623964 |
| resistance of potential probiotic lactic acid bacteria and bifidobacteria of african and european origin to antimicrobials: determination and transferability of the resistance genes to other bacteria. | probiotic bacteria and starter cultures of lactobacillus, weissella and bifidobacterium of african and european origins were studied and compared for their susceptibility to antimicrobials. the study included, for all isolates, determination of mics (minimal inhibitory concentration) for 24 antimicrobials, detection of resistance genes by pcr reactions using specific primers and sequencing of positive amplicons. the ability of lb. reuteri from africa to transfer the erythromycin resistance gene ... | 2008 | 18063151 |
| biodiversity of lactic acid bacteria in french wheat sourdough as determined by molecular characterization using species-specific pcr. | the lactic acid microflora of nine traditional wheat sourdoughs from the midi-pyrénées area (south western france) was previously isolated and preliminary characterized using conventional morphological and biochemical analysis. however, such phenotypic methods alone are not always reliable and have a low taxonomic resolution for identification of lactic acid bacteria species. in the present study, a total of 290 lab isolates were identified by pcr amplification using different sets of specific p ... | 2009 | 19651455 |
| polyphasic taxonomic studies of lactic acid bacteria associated with tunisian fermented meat based on the heterogeneity of the 16s-23s rrna gene intergenic spacer region. | the objective of this work was to investigate the structure and diversity of lactic acid bacteria (lab) communities in traditionally fermented meat collected from different areas of tunisia. a polyphasic study, which involves phenotypic tests and ribosomal dna-based techniques, was used to identify gram-positive and catalase-negative isolates. pcr amplification of the 16s-23s rdna isr of 102 isolates and other reference lab strains gave (1) one type of rrn operon (m-isr) for lactococci, (2) two ... | 2009 | 19669730 |
| diversity of lactic acid bacteria in suan-tsai and fu-tsai, traditional fermented mustard products of taiwan. | fu-tsai and suan-tsai are spontaneously fermented mustard products traditionally prepared by the hakka tribe of taiwan. we chose 5 different processing stages of these products for analysis of the microbial community of lactic acid bacteria (lab) by 16s rrna gene sequencing. from 500 lab isolates we identified 119 representative strains belonging to 5 genera and 18 species, including enterococcus (1 species), lactobacillus (11 species), leuconostoc (3 species), pediococcus (1 species), and weiss ... | 2009 | 19700215 |
| identification of lactic acid bacteria isolated from tarhana, a traditional turkish fermented food. | tarhana is a traditional fermented product produced from a mixture of spontaneously fermented yogurt and wheat flour in turkey. the aims of the present study were to enumerate and identify for the first time by molecular biology-based methods predominant lactic acid bacteria (lab) isolated during processing of tarhana. samples were collected from eight different regions of turkey. in order to explore the relationship between raw material and the microbiology of tarhana, yogurt and wheat flour we ... | 2009 | 19703719 |
| lactobacillus and bifidobacterium diversity in horse feces, revealed by pcr-dgge. | lactobacillus equi, lactobacillus hayakitensis, lactobacillus johnsonii, and weissella confusa/cibaria were the dominant species in 12 south african horses. the bifidobacterium-group was detected in the feces of only one of the 12 horses. sequencing of the nested-pcr amplicon identified the bifidobacterium-group as parascardovia denticolens. cell numbers of l. equi, l. hayakitensis, and w. confusa/cibaria were consistent in all samples. p. denticolens, bifidodobacterium pseudolongum, and a phylo ... | 2009 | 19730939 |
| effect of protective compounds on the survival, electrolyte leakage, and lipid degradation of freeze-dried weissella paramesenteroides lc11 during storage. | the effect of cryoprotectants (maltodextrin+glycerol) and cryoprotectants+antioxidant [ascorbic acid and/or butylated hydroxytoluene (bht)] mixtures on the survival, electrolyte leakage, and lipid degradation of freeze-dried weissella paramesenteroides lc11 during storage was investigated and compared with that of the control (cells without additives) over a 90-day storage period at 4 or 20 degrees in glass tubes with water activity (a(w)) of 0.23. the survival, electrolyte leakage, and lipid de ... | 2009 | 19734719 |
| idiosyncratic features in trnas participating in bacterial cell wall synthesis. | the femx(wv) aminoacyl transferase of weissella viridescens initiates the synthesis of the side chain of peptidoglycan precursors by transferring l-ala from ala-trna(ala) to udp-murnac-pentadepsipeptide. femx(wv) is an attractive target for the development of novel antibiotics, since the side chain is essential for the last cross-linking step of peptidoglycan synthesis. here, we show that femx(wv) is highly specific for incorporation of l-ala in vivo based on extensive analysis of the structure ... | 2007 | 17932062 |
| lactic acid bacteria population in children diagnosed with human immunodeficiency virus. | to determine the effect of trimethoprim/sulphamethoxazole treatment on the natural population of lactic acid bacteria in the intestinal tract and to determine if any of the strains developed resistance to antibiotics. | 2009 | 19751380 |
| screening of lactic acid bacteria from indonesia reveals glucansucrase and fructansucrase genes in two different weissella confusa strains from soya. | homopolysaccharide (glucan and fructan) synthesis from sucrose by sucrase enzymes in lactic acid bacteria (lab) has been well studied in the genera leuconostoc, streptococcus and lactobacillus. this study aimed to identify and characterize genes encoding glucansucrase/glucosyltransferase (gtf) and fructansucrases/fructosyltransferase (ftf) enzymes from genomic dna of 'rare' indonesian exopolysaccharide-producing lab. from a total of 63 exopolysaccharide-producing lab isolates obtained from foods ... | 2009 | 19758326 |
| weissella fabaria sp. nov., from a ghanaian cocoa fermentation. | two lactic acid bacteria, strains 257(t) and 252, were isolated from traditional heap fermentations of ghanaian cocoa beans. 16s rrna gene sequence analysis of these strains allocated them to the genus weissella, showing 99.5 % 16s rrna gene sequence similarity towards weissella ghanensis lmg 24286(t). whole-cell protein electrophoresis, fluorescent amplified fragment length polymorphism fingerprinting of whole genomes and biochemical tests confirmed their unique taxonomic position. dna-dna hybr ... | 2010 | 19801391 |
| development of a pcr assay for the strain-specific identification of probiotic strain lactobacillus paracasei impc2.1. | recent investigations clearly indicate that the probiotic bacterium lactobacillus paracasei impc2.1 can be incorporated into vegetables to obtain innovative probiotic foods whose marketing has been authorized by the italian ministry of health. in this study, strain impc2.1 was characterized at a molecular level in order to define its taxonomic position and to develop a pcr test for strain-specific identification. molecular methods, such as 16s rrna gene sequencing and multiplex pcr, have provide ... | 2009 | 19833402 |
| genome diversity in the genera fructobacillus, leuconostoc and weissella determined by physical and genetic mapping. | pulsed-field gel electrophoresis analysis of chromosomal single and double restriction profiles of 17 strains belonging to three genera of 'leuconostocaceae' was done, resulting in physical and genetic maps for three fructobacillus, six leuconostoc and four weissella strains. asci, i-ceui, noti and sfii restriction enzymes were used together with southern hybridization of selected probes to provide an assessment of genomic organization in different species. estimated genome sizes varied from 140 ... | 2010 | 19892761 |
| genotypic diversity of lactic acid bacteria isolated from african traditional alkaline-fermented foods. | to identify and compare lactic acid bacteria (lab) isolated from alkaline fermentations of cassava (manihot esculenta crantz) leaves, roselle (hibiscus sabdariffa) and african locust bean (parkia biglobosa) seeds for production of, respectively, ntoba mbodi, bikalga and soumbala. | 2010 | 19895650 |
| weissella beninensis sp. nov., a motile lactic acid bacterium from submerged cassava fermentations, and emended description of the genus weissella. | four gram-positive, catalase-negative, short rod-shaped or coccoid, heterofermentative lactic acid bacterial strains (2l24p13(t), 1l48p15, 1l24p31 and 1l24p34) with unusual phenotypic and genotypic properties were isolated from submerged fermenting cassava on mrs agar. all strains were motile, grew at 15 degrees c, produced dl-lactic acid from glucose with gas formation and produced ammonia from arginine. acid was produced from d-fructose, d-galactose, d-glucose, lactose, maltose, d-mannose, mel ... | 2010 | 19897612 |
| isolation and characterization of lactic acid bacteria from yan-dong-gua (fermented wax gourd), a traditional fermented food in taiwan. | yan-dong-gua (fermented wax gourd; a traditional fermented food in taiwan) samples were collected at five time intervals from a fixed fermenting bucket. eighty-five cultures of lactic acid bacteria (lab) were isolated from yan-dong-gua samples, and the isolates were divided into classes by phenotype and then groups by restriction fragment length polymorphism analysis and sequencing of 16s ribosomal dna. phenotypic and biochemical characteristics identified two bacterial groups (a and b) and show ... | 2009 | 19914580 |
| effect of high pressure on the microbiological quality of cooked chicken during storage at normal and abuse refrigeration temperatures. | vacuum-packaged cooked poultry meat was treated at a range of pressures (400-600 mpa) and hold times (1, 2 and 10 min), followed by storage at 4 degrees , 8 degrees or 12 degrees c for up to 35 days. weissella viridescens was found to be the dominant microorganism in the pressure-treated meat, constituting 100% of the microflora identified at 500 and 600 mpa. none of the pressure-treated samples had obvious signs of spoilage during the 35 day storage period, even when the weissella count was >7 ... | 2010 | 20141945 |
| identification of lactic acid bacteria associated with the production of plaa-som, a traditional fermented fish product of thailand. | plaa-som is a thai fermented fish product for which whole fish or fish fillets are fermented with either cooked rice or steamed sticky rice, salt, and garlic. a total of 762 lactic acid bacteria (lab) were isolated during plaa-som fermentation by culture on caco(3)-mrs agar plates. they were screened and grouped by amplified ribosomal dna restriction analysis (ardra), giving six groups that were identified by ribosomal dna sequencing as lactococcus garvieae, streptococcus bovis, weissella cibari ... | 2010 | 20167386 |
| seasonal and regional diversity of maple sap microbiota revealed using community pcr fingerprinting and 16s rrna gene clone libraries. | an arbitrary primed community pcr fingerprinting technique based on capillary electrophoresis was developed to study maple sap microbial community characteristics among 19 production sites in québec over the tapping season. presumptive fragment identification was made with corresponding fingerprint profiles of bacterial isolate cultures. maple sap microbial communities were subsequently compared using a representative subset of 13 16s rrna gene clone libraries followed by gene sequence analysis. ... | 2010 | 20202776 |
| probiotic table olives: microbial populations adhering on olive surface in fermentation sets inoculated with the probiotic strain lactobacillus paracasei impc2.1 in an industrial plant. | this study reports the dynamics of microbial populations adhering on the surface of debittered green olives cv. bella di cerignola in fermentation sets inoculated with the probiotic strain lactobacillus paracasei impc2.1 in different brining conditions (4% and 8% (w/v) nacl) at room temperature and 4 degrees c. the probiotic strain successfully colonized the olive surface dominating the natural lab population and decreasing the ph of brines to <or=5.0 after 30 days until the end of fermentation. ... | 2010 | 20226556 |
| culture-independent analysis of lactic acid bacteria diversity associated with mezcal fermentation. | mezcal is an alcoholic beverage obtained from the distillation of fermented juices of cooked agave spp. plant stalks (agave must), and each region in mexico with denomination of origin uses defined agave species to prepare mezcal with unique organoleptic characteristics. during fermentation to produce mezcal in the state of tamaulipas, not only alcohol-producing yeasts are involved, but also a lactic acid bacterial community that has not been characterized yet. in order to address this lack of k ... | 2010 | 20383505 |
| exopolysaccharide-forming weissella strains as starter cultures for sorghum and wheat sourdoughs. | the addition of sourdough fermented with lactic acid bacteria synthesizing organic acids and oligo- and exopolysaccharides (eps) from sucrose enhances texture, nutritional value, shelf life, and machinability of wheat, rye, and gluten-free bread. this study compared acetate, mannitol, and oligosaccharide formation of eps-producing strains of weissella and leuconostoc spp. to the traditional sourdough starter lactobacillus sanfranciscensis. in broth, leuconostoc strains generally formed acetate a ... | 2010 | 20405917 |
| phenotypic and genetic heterogeneity of lactic acid bacteria isolated from "alheira", a traditional fermented sausage produced in portugal. | the aim of this study was to evaluate the phenotypic and genetic heterogeneity of lactic acid bacteria (lab) isolated from "alheira", a fermented sausage produced in portugal. lab were identified to genus and species level by phenotypic characteristics, using genus or species-specific primers and sequencing of the gene encoding 16s rrna. two-hundred and eighty-three isolates were grouped into 14 species. lactobacillus plantarum was isolated from all sausages and enterococcusfaecalis from most of ... | 2009 | 20416703 |
| identification of lactic acid bacteria involved in the spoilage of pasteurized "foie gras" products. | the spoiling microflora of a re-packaged french "foie gras" product was studied. a total of 54 isolates, originating from two different factories, were identified using phenotypical and molecular methods (partial 16s rdna sequencing). weissella viridescens was the main species detected in the products from factory 1 (64% of the isolates). these products had a low lactic acid concentration and were considered as non-spoiled. the microflora of factory 2 was dominated mainly by the genus lactobacil ... | 2010 | 20416816 |
| exopolysaccharide synthesized by lactobacillus reuteri decreases the ability of enterotoxigenic escherichia coli to bind to porcine erythrocytes. | this study investigated the therapeutic potential of bacterial polysaccharides by employing a model system based on enteroxigenic escherichia coli (etec)-induced hemagglutination of erythrocytes. exopolysaccharides produced by strains of lactobacillus reuteri inhibited etec-induced hemagglutination of porcine erythrocytes. no effect was observed for dextran produced from weissella cibaria and commercially available oligo- and polysaccharides. | 2010 | 20472719 |
| development and analysis of microbial characteristics of an acidulocomposting system for the treatment of garbage and cattle manure. | an acidulocomposting system for the treatment of cattle manure with little emission of ammonia gas was developed, and the structure of its microbial community was investigated by denaturing gradient gel electrophoresis (dgge) and clone library construction. an acidulocomposting apparatus (bc20, 20 l) was operated for 79 days to treat 2 kg (wet wt) of garbage per 1 or 2 days. on day 80 of operation, the substrate was changed from garbage to cattle manure (1 kg of beef cattle manure was added to t ... | 2010 | 20547374 |
| influence of geographical origin and flour type on diversity of lactic acid bacteria in traditional belgian sourdoughs. | a culture-based approach was used to investigate the diversity of lactic acid bacteria (lab) in belgian traditional sourdoughs and to assess the influence of flour type, bakery environment, geographical origin, and technological characteristics on the taxonomic composition of these lab communities. for this purpose, a total of 714 lab from 21 sourdoughs sampled at 11 artisan bakeries throughout belgium were subjected to a polyphasic identification approach. the microbial composition of the tradi ... | 2007 | 17675431 |
| diversity of the predominant spoilage bacteria in water-boiled salted duck during storage. | the spoilage microbiota in water-boiled salted duck during storage at 4 degrees c was determined using culture-dependent and independent methods. analysis of the denaturing gradient gel electrophoresis (dgge) patterns of pcr amplicons targeting the v3 region of the 16s rdna and sequencing of the bands allowed profiling of the microbiota present in the duck. community dna extracts were prepared directly from water-boiled salted duck and from culturable bacterial fractions harvested from both mrs ... | 2010 | 20629890 |
| natural populations of lactic acid bacteria isolated from vegetable residues and silage fermentation. | natural populations of lactic acid bacteria (lab) and silage fermentation of vegetable residues were studied. fifty-two strains of lab isolated from cabbage, chinese cabbage, and lettuce residues were identified and characterized. the lab strains were gram-positive and catalase-negative bacteria, which were divided into 6 groups (a to f) according to morphological and biochemical characteristics. the strains in group a were rods that did not produce gas from glucose and formed the d and l isomer ... | 2010 | 20630231 |
| bar-coded pyrosequencing of 16s rrna gene amplicons reveals changes in ileal porcine bacterial communities due to high dietary zinc intake. | feeding high levels of zinc oxide to piglets significantly increased the relative abundance of ileal weissella spp., leuconostoc spp., and streptococcus spp., reduced the occurrence of sarcina spp. and neisseria spp., and led to numerical increases of all gram-negative facultative anaerobic genera. high dietary zinc oxide intake has a major impact on the porcine ileal bacterial composition. | 2010 | 20709843 |
| characterization of dextran-producing weissella strains isolated from sourdoughs and evidence of constitutive dextransucrase expression. | the study of exopolysaccharide production by heterofermentative sourdough lactic acid bacteria has shown that weissella strains isolated from sourdoughs produce linear dextrans containing α-(1→6) glucose residues with few α-(1→3) linkages from sucrose. in this study, several dextran-producing strains, weissella cibaria and weissella confusa, isolated from sourdough, were characterized according to carbohydrate fermentation, repetitive element-pcr fingerprinting using (gtg)(5) primers and glucans ... | 2010 | 20722740 |
| characterization of italian cheeses ripened under nonconventional conditions. | four italian cheeses (casciotta di urbino, barricato san martino, vento d'estate, and ubriaco di raboso) nonconventionally ripened under different plant materials (walnut leaves, herbs, hay, and wine by-products, respectively) were compared for compositional, microbiological, biochemical, and volatile profile characteristics. mean values for gross composition were rather similar. because primary starters were not used for manufacture, the endogenous lactic acid bacteria were mainly present (7.0 ... | 2007 | 17517708 |
| intestinal bacteroides species associated with coeliac disease. | to characterise the predominant species of bacterial populations associated with duodenal biopsies of paediatric patients with active and treated coeliac disease. | 2010 | 20972239 |
| bacteraemia caused by weissella confusa at a university hospital in taiwan, 1997-2007. | clin microbiol infect abstract: human infections caused by weissella confusa are rarely reported. ten patients with bacteraemia caused by w. confusa who were treated at a tertiary-care hospital in taiwan during 1997-2007 were studied. all isolates were initially misidentified as various lactobacillus and leuconostoc species by two commercial automated identification methods, and were confirmed to be w. confusa by 16s rrna sequencing analysis. mics of these isolates for ten antimicrobial agents w ... | 2010 | 21040157 |
| pcr monitoring of lactobacillus and bifidobacterium dynamics in fermentations by piglet intestinal microbiota. | a new group-specific primer (lact71r), targeting the 16s-23s rdna intergenic spacer region of lactobacillus, was tested in its specificity to amplify rdna of lactobacilli from piglet intestinal origin by polymerase chain reaction (pcr). lact71r and lab0677f, a lactobacillus group-specific primer targeting the 16s rdna, generated a common amplicon by pcr with dna from lactobacillus and pediococcus reference strains, but not from weissella strains. sequence analysis of clones obtained by pcr ampli ... | 2007 | 17440917 |
| genome sequence of weissella cibaria kacc 11862. | weissella cibaria kacc 11862 is a gram-positive, heterofermentative, leuconostoc-like lactic acid bacterium that is widely distributed in korean traditional foods such as kimchi. here we report the draft genome sequence of the type strain, w. cibaria kacc 11862 (1,599 known genes, 80 rna genes), which consists of 72 large contigs (>100 bp in size). | 2010 | 21097615 |
| weissella confusa: an unexpected cause of vancomycin-resistant gram-positive bacteremia in immunocompromised hosts. | h. salimnia, g.j. alangaden, r. bharadwaj, t.m. painter, p.h. chandrasekar, m.r. fairfax. weissella confusa: an unexpected cause of vancomycin-resistant gram-positive bacteremia in immunocompromised hosts. transpl infect dis 2011: 13: 294-298. all rights reserved abstract: we report the first case of weissella confusa bacteremia in an allogeneic hematopoietic stem cell transplant patient. after engraftment and discharge, the patient returned with fever and graft failure and was started on an emp ... | 2010 | 21156010 |
| structural analysis of enzyme-resistant isomaltooligosaccharides reveals the elongation of α-(1→3)-linked branches in weissella confusa dextran. | weissella confusa vtt e-90392 is an efficient producer of a dextran that is mainly composed of α-(1→6)-linked d-glucosyl units and very few α-(1→3) branch linkages. a mixture of the chaetomium erraticum endodextranase and the aspergillus niger α-glucosidase was used to hydrolyze w. confusa dextran to glucose and a set of enzyme-resistant isomaltooligosaccharides. two of the oligosaccharides (tetra- and hexasaccharide) were isolated in pure form and their structures elucidated. the tetrasaccharid ... | 2011 | 21207960 |
| weissella ceti sp. nov., isolated from beaked whales (mesoplodon bidens). | during an investigation into the microbiota of beaked whales, nine isolates were obtained from different organs of four animals. isolates were gram-positive, catalase-negative short rod-shaped or coccoid organisms. a phylogenetic analysis based on 16s rrna gene sequences of these isolates allocated them to the genus weissella, showing 96.3% and 96.0% 16s rrna gene sequence similarity with weissella viridescens and weissella minor, respectively. on the basis of phenotypic, physiological and phylo ... | 2011 | 21216921 |
| analysis of bacterial communities of traditional fermented west african cereal foods using culture independent methods. | in this study, the microbial composition of kunu-zaki and ogi, two popular foods in nigeria produced after natural, uncontrolled fermentation of cereals, was assessed by culture-independent molecular profiling methods. in particular, pcr-denaturing gradient gel electrophoresis and construction of 16s rrna gene clone libraries revealed the presence of diverse bacterial communities. dna sequencing of the highly variable v3 region of the 16s rrna genes obtained from pcr-dgge fingerprints identified ... | 2011 | 21272950 |
| natural populations of lactic acid bacteria associated with silage fermentation as determined by phenotype, 16s ribosomal rna and reca gene analysis. | one hundred and fifty-six strains isolated from corn (zea mays l.), forage paddy rice (oryza sativa l.), sorghum (sorghum bicolor l.) and alfalfa (medicago sativa l.) silages prepared on dairy farms were screened, of which 110 isolates were considered to be lactic acid bacteria (lab) according to their gram-positive and catalase-negative characteristics and, mainly, the lactic acid metabolic products. these isolates were divided into eight groups (a-h) based on the following properties: morpholo ... | 2011 | 21282025 |
| intestinal microbiota was assessed in cirrhotic patients with hepatitis b virus infection. intestinal microbiota of hbv cirrhotic patients. | to unravel the profile of intestinal microecological parameters in chinese patients with asymptomatic carriage of hepatitis b virus (hbv), chronic hepatitis b, decompensated hbv cirrhosis, and health controls and to establish their correlation with liver disease progression, we performed quantitative pcr and immunological techniques to investigate fecal parameters, including population of fecal predominant bacteria and the abundance of some virulence genes derived from escherichia coli, bacteroi ... | 2011 | 21286703 |
| novel pcr-based identification of weissella confusa using an aflp-derived marker. | an extensive use of weissella (w.) confusa is currently being made for the production of a variety of fermented foods and beverages although some strains of this species have emerged as opportunistic pathogens for humans and animals. nevertheless, no rapid methods are available for the reliable identification of w. confusa. we developed a novel pcr using aflp (amplified fragment length polymorphism)-derived primers for the rapid and unequivocal identification of w. confusa. fluorescent aflp of 3 ... | 2011 | 21296447 |
| diversity and dynamics of bacterial populations during spontaneous sorghum fermentations used to produce ting, a south african food. | ting is a spontaneously fermented sorghum food that is popular for its sour taste and unique flavour. insight of the microbial diversity and population dynamics during sorghum fermentations is an essential component of the development of starter cultures for commercial production of ting. in this study, bacterial populations associated with spontaneous sorghum fermentations were examined using a culture-independent strategy based on denaturing gradient gel electrophoresis and sequence analysis o ... | 2011 | 21300507 |
| phenotypic and genotypic analyses of lactic acid bacteria in local fermented food, breast milk and faeces of mothers and their babies. | lactic acid bacteria (lab) are generally accepted as beneficial to the host and their presence is directly influenced by ingestion of fermented food or probiotics. while the intestinal lactic microbiota is well-described knowledge on its routes of inoculation and competitiveness towards selective pressure shaping the intestinal microbiota is limited. in this study, lab were isolated from faecal samples of breast feeding mothers living in syria, from faeces of their infants, from breast milk as w ... | 2011 | 21300508 |
| metagenomic analysis of kimchi, a traditional korean fermented food. | kimchi, a traditional food in the korean culture, is made from vegetables by fermentation. in this study, metagenomic approaches were used to monitor changes in bacterial populations, metabolic potential, and overall genetic features of the microbial community during the 29-day fermentation process. metagenomic dna was extracted from kimchi samples obtained periodically and was sequenced using a 454 gs flx titanium system, which yielded a total of 701,556 reads, with an average read length of 43 ... | 2011 | 21317261 |
| congruence of evolutionary relationships inside the leuconostoc-oenococcus-weissella clade assessed by phylogenetic analysis of the 16s rrna gene, dnaa, gyrb, rpoc and dnak. | the phylogenetic structure of the leuconostoc-oenococcus-weissella clade was evaluated by comparison of 16s rrna gene, dnaa, gyrb, rpoc and dnak sequence analysis. phylogenies obtained with the different genes were in overall good agreement and a well-supported, almost fully resolved phylogenetic tree was obtained when the combined data were analysed in a bayesian approach. a rapid basal diversification of the three genera is suggested. evolutionary rates of the 16s rrna gene in these genera see ... | 2007 | 17267964 |
| isolation and partial characterization of halotolerant lactic acid bacteria from two mexican cheeses. | isolated strains of halotolerant or halophilic lactic acid bacteria (halab) from cotija and doble crema cheeses were identified and partially characterized by phenotypic and genotypic methods, and their technological abilities were studied in order to test their potential use as dairy starter components. humidity, a(w), ph, and salt concentration of cheeses were determined. genotypic diversity was evaluated by randomly amplified polymorphic dna-polymerase chain reaction. molecular identification ... | 2011 | 21327742 |
| biodiversity of lactic acid bacteria and yeasts in spontaneously-fermented buckwheat and teff sourdoughs. | in this study, four different laboratory scale gluten-free (gf) sourdoughs were developed from buckwheat or teff flours. the fermentations were initiated by the spontaneous biota of the flours and developed under two technological conditions (a and b). sourdoughs were propagated by continuous back-slopping until the stability was reached. the composition of the stable biota occurring in each sourdough was assessed using both culture-dependent and -independent techniques. overall, a broad spectru ... | 2010 | 21356457 |
| isolation and characterisation of a novel podoviridae-phage infecting weissella cibaria n 22 from nham, a thai fermented pork sausage. | a novel podoviridae lactic acid bacteria (lab) phage from nham, a thai fermented pork sausage, is reported. from a total of 36 samples, 41 isolates of lab were obtained and employed as hosts for the isolation of phages. from these lab, only one phage, designated φ 22, was isolated. the lactic acid bacterial isolate named n 22, sensitive to phage φ 22 infection was identified by an api 50 chl kit and n 22's complete sequence of the 16s rdna sequence. blastn analysis of the 16s rdna sequence revea ... | 2010 | 21356460 |
| severe infective endocarditis of native valves caused by weissella confusa detected incidentally on echocardiography. | weissella confusa is gram-positive, catalase-negative, short rod or coccobacillus that has been isolated from a wide variety of habitats. we describe a rare, severe infective endocarditis of native valves caused by w. confusa that was detected incidentally on echocardiography. the patient recovered completely with valvular replacement plus antibiotic therapy. | 2007 | 17052757 |
| increased dietary zinc oxide changes the bacterial core and enterobacterial composition in the ileum of piglets. | this study was conducted to investigate the effects of increased dietary zno on the bacterial core and enterobacterial composition in the small intestine of piglets that were fed diets containing a total of 124 or 3,042 mg of zn per kilogram of diet, respectively. zinc was supplemented to the basal diet as zno. bacterial 16s rrna genes of ileal dna extracts were pcr-amplified with 2 bar-coded primer sets and sequenced by 454 pyrosequencing. the bacterial core species were calculated from the rel ... | 2011 | 21383037 |
| diversity of weissella viridescens strains associated with "morcilla de burgos". | unidentified heterofermentative lactic acid bacterium (lab) isolates detected earlier in vacuum or modified atmosphere (ma) packaged "morcilla de burgos", a spanish cooked meat product, were identified in the present study. in the previous study, these strains had been studied by numerical analysis of hindiii rflp- and phenotyping. however, neither of these methods had resulted in species identification. even these unknown strains clustered together in the numerical analysis of the rflp patterns ... | 2006 | 16503360 |
| coaggregation ability of weissella cibaria isolates with fusobacterium nucleatum and their adhesiveness to epithelial cells. | in the present study, we evaluated the ability of weissella cibaria isolated from the oral cavity to coaggregate with fusobacterium nucleatum, and the adhesiveness of these strains to epithelial cells. w. cibaria efficiently coaggregated with f. nucleatum, and adhered to epithelial cells. we tested the effects of various factors on the coaggregation. the coaggregation and adhesiveness of w. cibaria disappeared upon exposure to pronase or licl, suggesting that proteinaceous components on the surf ... | 2005 | 16288835 |
| autoinducer-2-like activity in lactic acid bacteria isolated from minced beef packaged under modified atmospheres. | fifteen fingerprints (assigned to leuconostoc spp., leuconostoc mesenteroides, weissella viridescens, leuconostoc citreum, and lactobacillus sakei) of 89 lactic acid bacteria (lab) isolated from minced beef stored under modified atmospheres at various temperatures were screened for their ability to exhibit autoinducer-2 (ai-2)-like activity under certain growth conditions. cellfree meat extracts (cfme) were collected at the same time as the lab isolates and tested for the presence of ai-2-like m ... | 2011 | 21477479 |
| structure-based site-directed mutagenesis of the udp-murnac-pentapeptide-binding cavity of the femx alanyl transferase from weissella viridescens. | weissella viridescens femx (femx(wv)) belongs to the fem family of nonribosomal peptidyl transferases that use aminoacyl-trna as the amino acid donor to synthesize the peptide cross-bridge found in the peptidoglycan of many species of pathogenic gram-positive bacteria. we have recently solved the crystal structure of femx(wv) in complex with the peptidoglycan precursor udp-murnac-pentapeptide and report here the site-directed mutagenesis of nine residues located in the binding cavity for this su ... | 2005 | 15901708 |
| weissella confusa bacteremia in a liver transplant patient with hepatic artery thrombosis. | n.p. harlan, r.r. kempker, s.m. parekh, e.m. burd, d.t. kuhar. weissella confusa bacteremia in a liver transplant patient with hepatic artery thrombosis transpl infect dis 2011: 13: 290-293. all rights reserved abstract: a 54-year-old man with a history of nonalcoholic steatohepatitis and hepatocellular carcinoma presented 2 months after an orthotopic liver transplant with fever and abdominal pain. two weeks earlier, he had an hepatic artery thrombosis and a biliary stricture, for which an hepat ... | 2010 | 21504525 |
| purification, amino acid sequence and characterization of the class iia bacteriocin weissellin a, produced by weissella paramesenteroides dx. | weissella paramesenteroides dx has been shown to produce a 4450-da class iia bacteriocin, weissellin a, composed of 43 amino acids with the sequence knygngvycnkhkcsvdwatfsaniannsvamagltggnagn. the bacteriocin shares 68% similarity with leucocin c from leuconostoc mesenteroides. computational analyses predict that the bacteriocin is a hydrophobic molecule with a beta-sheet type conformation. weissellin a exhibited various levels of activity against all gram-positive bacteria tested, but was not a ... | 2011 | 21511463 |
| pcr-dgge analysis of bacterial community dynamics in kava beverages during refrigeration. | aims: kava beverages are highly perishable even under refrigerated conditions. this study aimed to investigate the bacterial community dynamics in kava beverages during refrigeration. methods and results: four freshly made kava beverages were obtained from kava bars and stored at 4°c. on days 0, 3 and 6, the aerobic plate count (apc), lactic acid bacteria (lab) count and yeast and mould count (ymc) of the samples were determined. meanwhile, bacterial dna was extracted from each sample and subj ... | 2011 | 21535042 |
| effect of lactic acid fermentation on antioxidant, texture, color and sensory properties of red and green smoothies. | weissella cibaria, lactobacillus plantarum, lactobacillus sp. and lactobacillus pentosus were variously identified from blackberries, prunes, kiwifruits, papaya and fennels by partial 16s rrna gene sequence. representative isolates from each plant species were screened based on the kinetics of growth on fruit juices. a protocol for processing and storage of red and green smoothies (rs and gs) was set up, which included fermentation by selected lactic acid bacteria starters and exo-polysaccharide ... | 2011 | 21569953 |
| weissella confusa: a rare cause of vancomycin resistant gram-positive bacteraemia. | we describe a case of bacteraemia caused by weissella confusa in a 48 year old male who was operated for adenocarcinoma of gastro-esophageal junction and maintained on total parenteral nutrition. blood cultures were positive for vancomycin resistant streptococci like organism which was identified as weissella confusa by 16srdna sequencing. | 2011 | 21596906 |
| 16s rrna-based identification of a glucan-hyperproducing weissella confusa. | a gram-positive, nonmotile, irregular, short, rod-shaped new strain of weissella confusa bacterium was isolated from fermented cabbage. the isolate was physiologically and biochemically characterised. the 16s rdna was amplified by polymerase chain reaction (pcr). the isolate was identified as weissella confusa (genbank accession number: gu138518.1) based on nucleotide homology and phylogenetic analysis. the isolate produces glucansucrase when grown in sucrose-supplemented culture medium which ca ... | 2011 | 21603260 |
| simulated cocoa pulp fermentations of cocoa-specific lactic acid bacteria reveal interesting starter culture strains for controlled cocoa bean fermentation. | among various lactic acid bacteria strains tested, cocoa-specific strains of lactobacillus fermentum were best adapted to the cocoa pulp ecosystem. they fermented glucose to lactic acid and acetic acid, reduced fructose to mannitol, and converted citric acid into lactic acid and 2,3-butanediol. | 2011 | 21803901 |
| genetic evidence that weissella kimchii choi et al. 2002 is a later heterotypic synonym of weissella cibaria björkroth et al. 2002. | the taxonomic positions of weissella kimchii and weissella cibaria were examined using phenotypic tests, 16s rrna gene sequencing and dna-dna hybridization. the two species displayed very similar sugar-fermentation patterns and produced the d-form of lactic acid. phylogenetic analysis showed that w. cibaria is the closest neighbour of w. kimchii, sharing about 99.7 % similarity in the 16s rrna gene sequence. dna-dna hybridization experiments further reinforced these results, demonstrating a 98.2 ... | 2004 | 15023961 |
| antifungal activity of 2 lactic acid bacteria of the weissella genus isolated from food. | ôçé in the present study, a total of 116 lactic acid bacteria (lab) strains isolated from mill flour and fermented cassava were screened for their antifungal activity. three strains among 116 were selected for their strongest inhibitory activity against food molds. these 3 strains were lactobacillus plantarum ve56, weissella cibaria fmf4b16, and w. paramesenteroides lc11. the compounds responsible for the antifungal activity were investigated. the strains displayed an inhibitory activity against ... | 2011 | 21729073 |
| nosocomial bacteraemia: the most neglected causes of death in europe? | | 2011 | 21729193 |
| molecular characterization of fecal microbiota in patients with viral diarrhea. | the study provides molecular analyses of fecal microbiota of diarrhea patients infected with four different types of viruses. fecal specimens from 52 patients with viral diarrhea (13 each of adenovirus, norovirus, rotavirus, and astrovirus) and six healthy individuals were collected and etiological viral agent was confirmed by enzyme immunoassay and specific pcr. to assess the changes in microbial diversity in patients with viral diarrhea, dna from stool were extracted and characterized by pcr-d ... | 2011 | 21739252 |
| diversity of lactic acid bacteria associated with traditional fermented dairy products in mongolia. | spontaneous milk fermentation has a long history in mongolia, and beneficial microorganisms have been handed down from one generation to the next for use in fermented dairy products. the objective of this study was to investigate the diversity of lactic acid bacteria (lab) communities in fermented yak, mare, goat, and cow milk products by analyzing 189 samples collected from 13 different regions in mongolia. the lab counts in these samples varied from 3.41 to 9.03 log cfu/ml. fermented yak and m ... | 2011 | 21700007 |
| lactic acid bacteria isolated from ethnic preserved meat products of the western himalayas. | we used culture- and molecular-biology-based methods to investigate the diversity of lactic acid bacteria (lab) in the ethnic chevon (goat) meat products chartayshya, jamma and arjia of the western himalayas. in six chartayshya, six jamma and four arjia samples, lab were the predominant microbial component involved in the fermentation of these samples, and the total lab population in arjia (7.8-á-¦-á0.1-álog cfu-ág(-1); mean-á-¦-ásd) was significantly higher (p-á<-á0.05) than in chartayshya (6.9 ... | 2011 | 21839380 |
| Microbial diversity in the midguts of field and lab-reared populations of the European corn borer Ostrinia nubilalis. | BACKGROUND: Insects are associated with microorganisms that contribute to the digestion and processing of nutrients. The European Corn Borer (ECB) is a moth present world-wide, causing severe economical damage as a pest on corn and other crops. In the present work, we give a detailed view of the complexity of the microorganisms forming the ECB midgut microbiota with the objective of comparing the biodiversity of the midgut-associated microbiota and explore their potential as a source of genes an ... | 2011 | 21738787 |
| The spoilage of air-packaged broiler meat during storage at normal and fluctuating storage temperatures. | Bacterial diversity and the major flora present on air-packaged broiler meat during storage at normal (4°C) and fluctuating storage temperatures (0-4°C and 4-10°C) were investigated using culture-dependent and culture-independent approaches. Culture-dependent analysis revealed that the growth of microflora was retarded when broiler meat was stored at lower temperatures (0-4°C). Denaturing gradient gel electrophoresis profiles showed that Staphylococcus spp., Pseudomonas spp., Acinetobacter spp., ... | 2012 | 22184446 |
| Genome sequence of Weissella thailandensis fsh4-2. | Weissella thailandensis fsh4-2 is a heterofermentative lactic acid bacterium isolated from the Korean fermented seafood condiment jeotkal. Here we report the draft genome sequence of W. thailandensis fsh4-2 (1,651 genes, 1,436 encoding known proteins, 183 encoding unknown proteins, 32 RNA genes), which consists of 50 large contigs of >100 bp. | 2011 | 21952542 |
| the fate of indigenous microbiota, starter cultures, escherichia coli, listeria innocua and staphylococcus aureus in danish raw milk and cheeses determined by pyrosequencing and quantitative real time (qrt)-pcr. | the purpose of this work was to study the bacterial communities in raw milk and in danish raw milk cheeses using pyrosequencing of tagged amplicons of the v3 and v4 regions of the 16s rdna and cdna. furthermore, the effects of acidification and ripening starter cultures, cooking temperatures and rate of acidification on survival of added escherichia coli, listeria innocua and staphylococcus aureus in cheeses at different stages of ripening were studied by pyrosequencing and quantitative real tim ... | 2011 | 22154239 |