| purification and properties of a thermophilic and thermostable dna polymerase from the archaebacterium sulfolobus solfataricus. | a dna-dependent dna polymerase was obtained in homogenous form from the thermoacidophilic archaebacterium sulfolobus solfataricus. the enzyme, purified 706-fold, has a molecular mass of about 110000 daltons as determined by gel filtration and by glycerol gradient centrifugation. it requires mg++ for its activity and has a ph optimum of 7.7. the activity is sharply dependent on the ionic strength. the enzyme is thermostable; its properties and activity requirements were characterized. the feature ... | 1990 | 2113898 |
| characterization of ribonuclease p from the archaebacterium sulfolobus solfataricus. | ribonuclease p is the endonuclease that removes the leader fragments from the 5'-ends of precursor trnas. the enzyme isolated from eubacteria contains a catalytic rna subunit. rnas also copurify with eukaryotic rnase p, although catalysis by those rnas has not been demonstrated. this paper reports the isolation and characterization of ribonuclease p from the thermoacidophilic archaebacterium sulfolobus solfataricus. archaebacteria are a primary evolutionary lineage, distinct from both eukaryotes ... | 1990 | 2115885 |
| in vitro transcription of two rrna genes of the archaebacterium sulfolobus sp. b12 indicates a factor requirement for specific initiation. | we describe a cell-free transcription system for the archaebacterium sulfolobus sp. b12 that specifically initiates transcription at the 5s rrna-encoding dna and the 16s/23s rrna-encoding dna promoters of the same species. with this crude extract system, specific initiation was absolutely dependent on the box a motif, a highly conserved promoter element in archaebacteria located approximately 25 base pairs upstream of transcription initiation sites. in vitro transcription of the rrna genes by pu ... | 1990 | 2116009 |
| structure of the archaebacterial 7s rna molecule. | the genes encoding the 7s rnas of the archaebacteria archaeoglobus fulgidus, methanosarcina acetivorans, sulfolobus, solfataricus, and thermococcus celer have been isolated. all four genes occur as single genomic copies and are flanked by sequences containing potential signals for transcriptional promotion and termination. the genes encode rna molecules approximately 300 nucleotides in length which conform strictly to a model of secondary structure common to all described archaebacterial 7s rnas ... | 1990 | 2116588 |
| determination of hydride transfer stereospecificity of nadh-dependent alcohol-aldehyde/ketone oxidoreductase from sulfolobus solfataricus. | this paper describes the determination of stereospecificity of hydride transfer reaction of an alcohol dehydrogenase isolated from the archaebacterium sulfolobus solfataricus. the 1h-nmr and ei-ms data indicate that the enzyme transfers the pro-r hydrogen from coenzyme to substrate and is therefore an a-specific dehydrogenase. | 1990 | 2121281 |
| isolation and sequencing of a new beta-galactosidase-encoding archaebacterial gene. | the gene lacs coding for a beta-galactosidase (beta gal; ec 3.2.1.23) has been cloned from the thermoacidophilic archaebacterium sulfolobus solfataricus, strain mt-4. it encodes a polypeptide chain of 489 amino acids (aa) (56,764 da) in good agreement with the value directly measured for the enzyme (60 +/- 2 kda per subunit). the aa composition of the enzyme and, in particular, its peculiarly low cysteine content (one cys per subunit) has been confirmed; at the same time, it has been observed th ... | 1990 | 2121622 |
| occurrence in the archaebacterium sulfolobus solfataricus of a ribosomal protein complex corresponding to escherichia coli (l7/l12)4.l10 and eukaryotic (p1)2/(p2)2.p0. | two-dimensional electrophoresis of total protein from 50 s ribosomal subunits of the archaebacterium sulfolobus solfataricus demonstrated a complex between two proteins that was stable in 6 m urea, but dissociable in detergent or below ph 5.5. the proteins, numbered l1 and l10 according to their electrophoretic mobilities, corresponded to escherichia coli ribosomal proteins l10 and l7/l12, respectively. the members of the complex were therefore designated sso l10e and sso l12e. sso l12e had othe ... | 1990 | 2121730 |
| purification and properties of a thermostable fumarate hydratase from the archaeobacterium sulfolobus solfataricus. | fumarate hydratase (ec 4.2.1.2) from the extremely thermophilic archaeobacterium solfolobus solfataricus has been purified to homogeneity by a rapid purification procedure using affinity chromatography and high-performance size-exclusion chromatography, and the enzyme's physical and biochemical properties have been determined. the native enzyme has a molecular mass of 170 kda and is composed of identical subunits with a molecular mass of 45 kda, thus indicating a tetrameric structure similar to ... | 1990 | 2124611 |
| mutational analysis of an archaebacterial promoter: essential role of a tata box for transcription efficiency and start-site selection in vitro. | by using a recently developed in vitro transcription assay, the 16s/23s rrna-encoding dna promoter from the archaebacterium sulfolobus sp. b12 was dissected by deletion and linker substitution mutagenesis. the analysis of 5' and 3' deletion mutants defined a core promoter region between positions -38 and -2 containing all information for efficient and specific transcription. further characterization of this region by linker substitution mutagenesis indicated two sequence elements important for p ... | 1990 | 2124695 |
| structure of an atpase operon of an acidothermophilic archaebacterium, sulfolobus acidocaldarius. | the nucleotide sequence of the operon of the atpase complex of an acidothermophilic archaebacterium, sulfolobus acidocaldarius, has been determined. in addition to the three previously reported genes for the alpha, beta, and c (proteolipid) subunits of the atpase complex (denda, k., konishi, j., oshima, t., date, t., and yoshida, m. (1989) j. biol. chem. 264, 7119-7121), the operon contained three other genes encoding hydrophilic proteins with molecular masses 25, 13, and 7 kda. the 25-kda prote ... | 1990 | 2147683 |
| cytochrome aa3 from sulfolobus acidocaldarius. a single-subunit, quinol-oxidizing archaebacterial terminal oxidase. | the thermoacidophilic archaebacterium sulfolobus acidocaldarius (dsm 369) extrudes protons when expending respiratory energy [moll, r. & schäfer, g. (1988) febs lett. 232, 359-363]. cytochromes of the membrane electron-transport systems are assumed to represent the proton pumps. only a- and b-type cytochromes can be found; no c-type cytochromes are present. of the two terminal oxidases [anemüller, s. & schäfer, g. (1989) febs lett. 244, 451-455] one shows an absorption band at 604-605 nm, typica ... | 1990 | 2166661 |
| reverse gyrase, a hallmark of the hyperthermophilic archaebacteria. | investigation of the presence of a reverse gyrase-like activity in archaebacteria revealed wide distribution of this activity in hyperthermophilic species, including methanogens and sulfur-dependent organisms. in contrast, no reverse gyrase activity was detected in mesophilic and moderately thermophilic organisms, which exhibited only an atp-independent activity of dna relaxation. these results suggest that the presence of reverse gyrase in archaebacteria is tightly linked to the high growth tem ... | 1990 | 2174859 |
| the dna polymerase from the archaebacterium sulfolobus acidocaldarius: a thermophilic and thermoresistant enzyme which can perform automated polymerase chain reaction. | a dna polymerase purified from the thermoacidophilic archaebacterium sulfolobus acidocaldarius was used to perform automated dna amplification at 70 degrees c as well as site directed mutagenesis by polymerase chain reaction (p.c.r.). the yield of amplification performed at optimum mgcl2 concentration for the taq or the s. acidocaldarius dna polymerase, for the same dna target, was equivalent. the ability of s. acidocaldarius dna polymerase to perform p.c.r. under less stringent requirement of m ... | 1990 | 2182028 |
| evidence for an additional archaebacterial gene cluster in halobacterium marismortui encoding ribosomal proteins hl46e and hl30. | a small and extremely basic ribosomal protein (hl46e) has been purified from halobacterium marismortui using reversed-phase high-performance liquid chromatography (hplc). the amino acid sequence of the protein was determined by automated n-terminal and internal sequence analysis. comparison of this sequence with other ribosomal protein sequences from eubacteria, archaebacteria and eukaryotes revealed a strong homology to sl46e from sulfolobus solfataricus, yeal46 from yeast and rl39 from rat. no ... | 1990 | 2207169 |
| purification and characterization of a liposomal-forming tetraether lipid fraction. | polar lipid e, ple, a native tetraether lipid mixture from sulfolobus acidocaldarius is shown to spontaneously form multilamellar liposomes in aqueous media. ple lipids were isolated as a single fraction from the crude lipid extract of s. acidocaldarius on a reverse-phase column followed by tlc and methanol precipitation. the methanol-precipitated mixture was able to form liposomes, whereas the non-precipitated material did not. it has thus been demonstrated, for the first time, that tetraether ... | 1990 | 2310392 |
| thermodynamic analysis of the temperature effect on the conformational behaviour of propylaminetransferase from sulfolobus solfataricus. | | 1990 | 2391228 |
| studies of the gtpase domain of archaebacterial ribosomes. | ribosomes from the methanogens methanococcus vannielii and methanobacterium formicicum catalyse uncoupled hydrolysis of gtp in the presence of factor ef-2 from rat liver (but not factor ef-g from escherichia coli). in this assay, and in poly(u)-dependent protein synthesis, they were sensitive to thiostrepton. in contrast, ribosomes from sulfolobus solfataricus did not respond to factor ef-2 (or factor ef-g) but possessed endogenous gtpase activity, which was also sensitive to thiostrepton. ribos ... | 1985 | 2411554 |
| simple repetitive sequences in the genomes of archaebacteria. | stretches of simple sequences poly(dg-dt).poly(dc-da), poly(dg-da).poly(dc-dt), poly(dg).poly(dc) and poly(da).poly(dt), the occurrence of which is a characteristic feature of eukaryotic genomes, are found in the genomes of archaebacteria halobacterium halobium and sulfolobus acidocaldarius. in s. acidocaldarius these sequences constitute a considerable portion of the genome; they belong to a class of repetitive sequences dispersed throughout the genome, being transcribed and found in rnas of di ... | 1987 | 2438164 |
| aminoglycoside-induced mistranslation in thermophilic archaebacteria. | the effect of selected aminoglycoside antibiotics on the translational accuracy of poly(u) programmed ribosomes derived from the thermophilic archaebacteria thermoplasma acidophilum, sulfolobus solfataricus, thermococcus celer and desulfurococcus mobilis has been determined. under optimum temperature and ionic conditions for polyphenylalanine synthesis, the four species investigated are found to be markedly diverse in their response to the miscoding-inducing action of aminoglycoside antibiotics. ... | 1988 | 2465484 |
| the structure and organization of the 16s ribosomal rna gene from the archaebacterium thermoplasma acidophilum. | the complete nucleotide sequence of the 16s rrna gene from thermoplasma acidophilum, as well as its 5' and 3' flanking regions, were determined by the dideoxynucleotide chain termination method. the 16s rrna gene encodes 1471 nucleotides. the primary and secondary structures of t. acidophilum 16s rrna both exhibit typical archaebacterial features. the sequence appears to be more closely related to 16s rrnas of the methanogen--halophile group than to those of the thermoacidophile group. secondary ... | 1989 | 2470478 |
| phylogenetic conservation of antigenic determinants in archaebacterial elongation factors (tu proteins). | by using affinity chromatography methods, we have purified elongation factor tu (ef-tu) proteins from a host of archaebacteria covering all known divisions in the archaebacterial tree except halophiles, and from such distantly related eubacteria as thermotoga maritima and escherichia coli. polyclonal antibodies were raised against the tu proteins of sulfolobus solfataricus, thermoproteus tenax, thermococcus celer, pyrococcus wosei, archaeoglobus fulgidus, methanococcus thermolitotrophicus, therm ... | 1989 | 2470483 |
| the aminoacylation of structurally variant phenylalanine trnas from mitochondria and various nonmitochondrial sources by bovine mitochondrial phenylalanyl-trna synthetase. | bovine mitochondrial (mt) phenylalanine trna (trnaphe) was purified on a large scale using a new hybridization assay method developed by the authors. although its melting profile suggested a loose higher order structure, presumably influenced by the apparent loss of d loop-t loop interaction necessary for forming a rigid l-shaped tertiary structure, its aminoacylation capacity catalyzed by mt phenylalanyl-trna synthetase (phers) was nearly equal to that of escherichia coli trnaphe. misaminoacyla ... | 1989 | 2473985 |
| archaebacterial histone-like proteins. purification and characterization of helix stabilizing dna binding proteins from the acidothermophile sulfolobus acidocaldarius. | four dna binding histone-like proteins have been purified from the nucleoid of the acidothermophilic archaebacterium sulfolobus acidocaldarius to homogeneity employing dna-cellulose chromatography and carboxymethylcellulose chromatography. the molecular weights of these proteins are in the range 8,000-12,500. immunoblotting results suggest that a few antigenic determinants are common among these proteins which could not be detected by immunodiffusion. spectroscopic properties of the proteins hav ... | 1989 | 2477367 |
| chemiosmotic energy conversion of the archaebacterial thermoacidophile sulfolobus acidocaldarius: oxidative phosphorylation and the presence of an f0-related n,n'-dicyclohexylcarbodiimide-binding proteolipid. | the energy-transducing mechanism of the thermoacidophilic archaebacterium sulfolobus acidocaldarius dsm 639 has been studied, addressing the question whether chemiosmotic proton gradients serve as an intermediate energy store driving an f0f1-analogous atp synthase. at ph 3.5, respiring s. acidocaldarius cells developed an electrochemical potential of h+ ions, consisting mainly of a proton gradient and a small inside-negative membrane potential. the steady-state proton motive force of 140 to 160 ... | 1989 | 2478523 |
| thermostable dna polymerase from the archaebacterium sulfolobus acidocaldarius. purification, characterization and immunological properties. | we have purified to near homogeneity a dna polymerase from the thermoacidophilic archaebacterium sulfolobus acidocaldarius. sodium dodecyl sulfate gel electrophoresis of the purified enzyme revealed a polypeptide of 100 kda. on the basis of a stokes radius of 4.2 nm and a sedimentation coefficient of 6 s, the purified enzyme has an estimated molecular mass of 109 kda. these results are consistent with the enzyme being a monomer of 100 kda. in addition a polyclonal antiserum, obtained by injectio ... | 1989 | 2492226 |
| structural and functional exchangeability of 5 s rna species from the eubacterium e.coli and the thermoacidophilic archaebacterium sulfolobus solfataricus. | the role of 5 s rna within the large ribosomal subunit of the extremely thermophilic archaebacterium sulfolobus solfataricus has been analysed by means of in vitro reconstitution procedures. it is shown that sulfolobus 50 s subunits reconstituted in the absence of 5 s rna are inactive in protein synthesis and lack 2-3 ribosomal proteins. furthermore, it has been determined that in the course of the in vitro assembly process sulfolobus 5 s rna can be replaced by the correspondent rna species of e ... | 1989 | 2493632 |
| an archaebacterial gene from methanococcus vannielii encoding a protein homologous to the ribosomal protein l10 family. | an open reading frame upstream of the methanococcus vannielii l12 gene has been detected. the beginning of this open reading frame agrees with the n-terminal region of a protein (mval10) which has been isolated from the 50 s ribosomal subunit of m. vannielii and sequenced. the length of this gene is 1008 nucleotides, coding for 336 amino acids. excellent sequence similarities were found to the l10-like ribosomal proteins from halobacterium halobium and man. the n-terminal part of the mval10 prot ... | 1989 | 2497026 |
| archaebacterial malate dehydrogenase: the amino-terminal sequence of the enzyme from sulfolobus acidocaldarius is homologous to the eubacterial and eukaryotic malate dehydrogenases. | 42 residues of the n-terminal amino acid sequence of malate dehydrogenase from the thermoacidophilic archaebacterium sulfolobus acidocaldarius have been determined as vkvafigvgrgvgqtiayntivngyadevmlydvvpelptkk. in eubacterial and eukaryotic enzymes this region is known to encompass residues involved in pyridine nucleotide binding. in the archaebacterial enzyme the residues gly-7, gly-11 and asp-33 are also present. the data suggest that in the enzyme from s. acidocaldarius like in the other mala ... | 1989 | 2497031 |
| comparison of initiating abilities of primers of different length in polymerization reactions catalyzed by dna polymerases from thermoacidophilic archaebacteria. | optimal conditions for polymerization reaction catalyzed on poly(da) and poly(dt) templates by dna polymerases from thermoacidophilic archaebacteria--dna polymerase a from sulfolobus acidocaldarius and dna polymerase b from thermoplasma acidophilum--have been established. values of km and vmax (60 degrees c) for a set of primers d(pa)n and d(pt)n have been estimated. minimal primers for both enzymes are dnmp. lengthening of primers by each mononucleotide increases their affinity about 2.16-fold. ... | 1989 | 2497779 |
| nucleoside 5'-triphosphates modified at sugar residues as substrates for dna polymerase from the thermoacidophilic archaebacterium sulfolobus acidocaldarius. | the ability of a wide variety of nucleoside 5'-triphosphates with modified sugar moiety to serve as substrates in dna synthesis catalyzed by dna polymerase a from the archaebacterium sulfolobus acidocaldarius was studied. most of the dntp analogs tested are shown to be specific terminating substrates for the synthesis irreversibly blocking further elongation of a nascent chain. the most powerful inhibitors were found to be 3'-amino derivatives of deoxy and arabino nucleoside triphosphates, while ... | 1989 | 2497780 |
| comparative studies of ribosomal proteins and their genes from methanococcus vannielii and other organisms. | using data from a partial protein sequence analysis of ribosomal proteins derived from the archaebacterium methanococcus vannielii, oligonucleotide probes were synthesized. the probes enabled us to localize several ribosomal protein genes and to determine their nucleotide sequences. the amino acid sequences that were deduced from the genes correspond to proteins l12 and l10 from the rif operon, according to the genome organization in escherichia coli, and to proteins l23 and l2, which have compa ... | 1989 | 2497935 |
| organization of genes encoding the l11, l1, l10, and l12 equivalent ribosomal proteins in eubacteria, archaebacteria, and eucaryotes. | archaebacterial and eucaryotic cytoplasmic ribosomes contain proteins equivalent to the l11, l1, l10, and l12 proteins of the eubacterium escherichia coli. in e. coli the genes encoding these ribosomal proteins are clustered, cotranscribed, and autogenously regulated at the level of mrna translation. genomic restriction fragments encoding the l11e, l1e, l10e, and l12e (equivalent) proteins from two divergent archaebacteria. halobacterium cutirubrum and sulfolobus solfataricus, and the l10e and l ... | 1989 | 2497939 |
| structure and evolution of the l11, l1, l10, and l12 equivalent ribosomal proteins in eubacteria, archaebacteria, and eucaryotes. | the genes corresponding to the l11, l1, l10, and l12 equivalent ribosomal proteins (l11e, l1e, l10e, and l12e) of escherichia coli have been cloned and sequenced from two widely divergent species of archaebacteria, halobacterium cutirubrum and sulfolobus solfataricus, and the l10 and four different l12 genes have been cloned and sequenced from the eucaryote saccharomyces cerevisiae. alignments between the deduced amino acid sequences of these proteins and to other available homologous proteins o ... | 1989 | 2497941 |
| archaebacterial dna-dependent rna polymerases testify to the evolution of the eukaryotic nuclear genome. | genes for dna-dependent rna polymerase components b, a, and c from the archaebacterium sulfolobus acidocaldarius and for components b", b', a, and c from the archaebacterium halobacterium halobium were cloned and sequenced. they are organized in gene clusters in the order above, which corresponds to the order of the homologous rpob and rpoc genes in the corresponding operon of the escherichia coli genome. derived amino acid sequences of archaebacterial components a and c were aligned with each o ... | 1989 | 2499884 |
| organization and nucleotide sequence of the genes encoding the large subunits a, b and c of the dna-dependent rna polymerase of the archaebacterium sulfolobus acidocaldarius. | the genes for the three large subunits a, b and c, of the dna-dependent rna polymerase of the archaebacterium sulfolobus acidocaldarius dsm 639, were identified and characterized. the three genes follow each other immediately in the order b-a-c, which corresponds to that found in the rpobc operon of the escherichia coli genome. the transcription products formed in vivo were studied by northern analysis and the start-points were determined by s1-nuclease mapping and primer directed extension anal ... | 1989 | 2501756 |
| stability and activity of a thermostable malic enzyme in denaturants and water-miscible organic solvents. | a study was made of the effects of common protein denaturants and water-miscible organic solvents on both the stability and activity of the malic enzyme [(s)-malate:nadp+ oxidoreductase (oxaloacetate-decarboxylating); ec 1.1.1.40] from the extreme thermoacidophilic archaebacterium sulfolobus solfataricus. at 25 degrees c, the enzyme was not inactivated in 4 m urea or 0.05% sds over 24 h, while the half-life was 30 min in 6 m guanidine hydrochloride and 5 h in 0.075% sds. the enzyme stability in ... | 1989 | 2502399 |
| localisation of the binding site for the initiating substrate on the rna polymerase from sulfolobus acidocaldarius. | rna polymerase from the archaebacterium sulfolobus acidocaldarius was chemically modified with amp o-formylphenyl ester followed by reduction with borohydride. the modified protein catalyzes the labeling of its own largest subunit when incubated with [alpha-33p]utp in the presence of poly[d(a-t)]. on cleaving of the labeled protein using cyanogen bromide, hydroxylamine or amino acid-specific endoproteinases for a very brief period, the pattern and size of the radioactive fragments formed are bes ... | 1989 | 2502428 |
| a small basic ribosomal protein in sulfolobus solfataricus equivalent to l46 in yeast: structure of the protein and its gene. | the structure of the gene for a small, very basic ribosomal protein in sulfolobus solfataricus has been determined and the structure of the protein coded by this gene (l46e) has been confirmed by partial amino acid sequencing. the protein shows substantial sequence homology to the eukaryotic ribosomal proteins l39 in rat and l46 in yeast. there is no sequence homology to any of the eubacterial ribosomal proteins suggesting that this protein is absent in the eubacterial ribosome. | 1989 | 2502431 |
| polyamines of sulfur-dependent archaebacteria and their role in protein synthesis. | several strains of the sulfur-dependent archaebacterium, sulfolobus, were analyzed for their polyamine content. caldine (norspermidine), spermidine, and thermine were found to be major components in all of the cells tested. the most abundant polyamine in all cultures examined was spermidine. the langworthy strain had the highest spermine content, whereas s. acidocaldarius strain no. 7 was devoid of this polyamine. cultures of strain no. 7 grown at 70 degrees c were rich in spermidine and caldine ... | 1989 | 2504703 |
| purification of glycerol dialkyl nonitol tetraether from sulfolobus acidocaldarius. | a modified procedure for extraction and purification of hydrolyzed archaebacterial lipids is described. lipids were extracted from sulfolobus acidocaldarius using a soxhlet extraction procedure followed by trichloroacetic acid solvent-extraction of the residue. the yield of total extractable material by this protocol was 14% which, after a two-phase wash, yielded 10% lipid. modifications to the published steps for purifying the subsequently hydrolyzed lipids were developed to purify glycerol dia ... | 1989 | 2507722 |
| preliminary x-ray crystallographic study of malate dehydrogenases from the thermoacidophilic archaebacteria thermoplasma acidophilum and sulfolobus acidocaldarius. | malate dehydrogenases from the thermoacidophilic archaebacteria thermoplasma acidophilum and sulfolobus acidocaldarius have been crystallized and characterized by x-ray diffraction measurements. crystals of the enzyme from t. acidophilum display space-group symmetry p2(1), a = 63 a, b = 135 a, c = 83 a and beta = 105 degrees; they scattered to approximately 4 a resolution. two crystal modifications of malate dehydrogenase from s. acidocaldarius were characterized; one displayed trigonal symmetry ... | 1989 | 2507788 |
| nucleotide sequence of a thermostable beta-galactosidase from sulfolobus solfataricus. | | 1989 | 2508066 |
| further kinetic and molecular characterization of an extremely heat-stable carboxylesterase from the thermoacidophilic archaebacterium sulfolobus acidocaldarius. | the carboxylesterase (serine esterase, ec 3.1.1.1) from sulfolobus acidocaldarius was purified 940-fold to homogeneity by an improved purification procedure with a yield of 57%. in the presence of alcohols the enzyme catalyses the transfer of the substrate acyl group to alcohols in parallel to hydrolysis. the results show the existence of an alcohol-binding site and a competitive partitioning of the acyl-enzyme intermediate between water and alcohols. aniline acts also as a nucleophilic acceptor ... | 1989 | 2508625 |
| dna polymerase from sulfolobus acidocaldarius. replication at high temperature of long stretches of single-stranded dna. | the activity of a homogeneous dna polymerase from the thermophilic archaebacterium, sulfolobus acidocaldarius, on a singly primed, single-stranded recombinant phage m13 dna has been examined. at the optimal temperature (70 to 75 degrees c) this template is efficiently replicated in ten minutes using a ratio of enzyme molecule to primed-template of 0.8. analysis of dna products during the course of polymerization shows that species of quite homogeneous size are observed and that the number of pri ... | 1989 | 2511325 |
| biosynthesis of caldariellaquinone in sulfolobus spp. | the biosynthesis of caldariellaquionone (cq) was studied in species of sulfolobus by measuring the incorporation of stable isotopically labeled tyrosines into cq. by feeding a series of tyrosines labeled with deuterium or 13c and then measuring the extent and position at which label was incorporated into cq by mass spectrometry, it was shown that more than 95% of the label was incorporated into the benzo[b]thiophen-4,7-quinone moiety of cq. from the labeling experiments, it is concluded that the ... | 1989 | 2512282 |
| phenotypic characterization of the archaebacterial genus sulfolobus: comparison of five wild-type strains. | though amenable to routine manipulation and a popular subject of molecular genetic and biochemical studies on archaebacteria, the genus sulfolobus has remained poorly described in phenotypic terms. to delineate their physiological capabilities and diversity, five laboratory strains, including type strains of the described species sulfolobus acidocaldarius and s. solfataricus, were compared with respect to a variety of growth and biochemical parameters, including component profile of the surface- ... | 1989 | 2512283 |
| polyphosphate as a source of phosphoryl group in protein modification in the archaebacterium sulfolobus acidocaldarius. | the incubation of polyphosphates with the ribosomal fraction of sulfolobus acidocaldarius leads to the covalent attachment of phosphate to threonine residue(s) of a single 40,000 mr protein. the hydrolysis kinetics of this protein showed that polyphosphate might be the modifying group. the reaction requires 2 mm mn2+ ions and is time-dependent. atp strongly inhibits the transfer of phosphate from polyphosphate, indicating that this process is catalyzed by an enzyme differing from the well-known ... | 1989 | 2513000 |
| cloning and sequencing of the gene coding for aspartate aminotransferase from the thermoacidophilic archaebacterium sulfolobus solfataricus. | the gene coding for aspartate aminotransferase (ec 2.6.1.1) has been cloned from the extreme thermoacidophilic archaebacterium sulfolobus solfataricus strain mt4. partial sequence data obtained directly from the purified protein and from the two cyanogen-bromide-generated peptides confirm the primary structure of aspartate aminotransferase inferred from the nucleotide sequence of its gene. a comparison of the enzyme with other aminotransferases revealed an interesting similarity with tyrosine am ... | 1989 | 2513189 |
| sequence alignment and evolutionary comparison of the l10 equivalent and l12 equivalent ribosomal proteins from archaebacteria, eubacteria, and eucaryotes. | the genes corresponding to the l10 and l12 equivalent ribosomal proteins (l10e and l12e) of escherichia coli have been cloned and sequenced from two widely divergent species of archaebacteria, halobacterium cutirubrum and sulfolobus solfataricus. the deduced amino acid sequences of the l10e and l12e proteins have been compared to each other and to available eubacterial and eucaryotic sequences. we have identified the human p0 protein as the eucaryotic l10e. the l10e proteins from the three kingd ... | 1989 | 2515294 |
| a gene encoding the proteolipid subunit of sulfolobus acidocaldarius atpase complex. | an analysis of genes for the major two subunits of the membrane-associated atpase from an acidothermophilic archaebacterium, sulfolobus acidocaldarius, suggested that it belongs to a different atpase family from the f1-atpase (denda, k., konishi, j., oshima, t., date, t., and yoshida, m. (1988) j. biol. chem. 263, 17251-17254). in the same operon of the above two genes we found a gene encoding a very hydrophobic protein of 101 amino acids (mr = 10,362). a proteolipid was purified from the membra ... | 1989 | 2523390 |
| the h+ atpase regulatory subunit of methanococcus thermolithotrophicus: amplification of an 800 bp fragment by polymerase chain reaction. | an 800 bp fragment of methanococcus thermolithotrophicus genomic dna was amplified by the polymerase chain reaction method using primers designed from conserved regions of the v-type h+ atpase regulatory subunits from the archaebacterium sulfolobus, and several eukaryotes. although more than one product was obtained, only one of them had the expected size and was exclusively amplified in the presence of the left and right primers. the dna and the deduced protein sequences of the putative methano ... | 1989 | 2526753 |
| evolution of the vacuolar h+-atpase: implications for the origin of eukaryotes. | active transport across the vacuolar components of the eukaryotic endomembrane system is energized by a specific vacuolar h+-atpase. the amino acid sequences of the 70- and 60-kda subunits of the vacuolar h+-atpase are approximately equal to 25% identical to the beta and alpha subunits, respectively, of the eubacterial-type f0f1-atpases. we now report that the same vacuolar h+-atpase subunits are approximately equal to 50% identical to the alpha and beta subunits, respectively, of the sulfur-met ... | 1989 | 2528146 |
| molecular evolution of h+-atpases. i. methanococcus and sulfolobus are monophyletic with respect to eukaryotes and eubacteria. | the classification of methanogenic bacteria as archaebacteria based on 16 s rrna sequence analysis is currently in dispute. to provide an alternative molecular marker, the polymerase chain reaction technique was used to amplify a 930 bp fragment of methanococcus thermolithotrophicus genomic dna corresponding to the catalytic domain of the membrane h+-atpase. the deduced amino acid sequence was 54-58% identical to the approximately 70 kda subunits of sulfolobus acidocaldarius and the eukaryotic v ... | 1989 | 2528356 |
| studies on dna polymerases and topoisomerases in archaebacteria. | we have isolated dna polymerases and topoisomerases from two thermoacidophilic archaebacteria: sulfolobus acidocaldarius and thermoplasma acidophilum. the dna polymerases are composed of a single polypeptide with molecular masses of 100 and 85 kda, respectively. antibodies against sulfolobus dna polymerase did not cross react with thermoplasma dna polymerase. whereas the major dna topoisomerase activity in s. acidocaldarius is an atp-dependent type i dna topoisomerase with a reverse gyrase activ ... | 1989 | 2541877 |
| the phylogenetic relations of dna-dependent rna polymerases of archaebacteria, eukaryotes, and eubacteria. | unrooted phylogenetic dendrograms were calculated by two independent methods, parsimony and distance matrix analysis, from an alignment of the derived amino acid sequences of the a and c subunits of the dna-dependent rna polymerases of the archaebacteria sulfolobus acidocaldarius and halobacterium halobium with 12 corresponding sequences including a further set of archaebacterial a+c subunits, eukaryotic nuclear rna polymerases, pol i, pol ii, and pol iii, eubacterial beta' and chloroplast beta' ... | 1989 | 2541879 |
| amino acid sequence of the alpha and beta subunits of methanosarcina barkeri atpase deduced from cloned genes. similarity to subunits of eukaryotic vacuolar and f0f1-atpases. | the atpa and atpb genes coding for the alpha and beta subunits, respectively, of membrane atpase were cloned from a methanogen methanosarcina barkeri, and the amino acid sequences of the two subunits were deduced from the nucleotide sequences. the methanogenic alpha (578 amino acid residues) and beta (459 amino acid residues) subunits were highly homologous to the large and small subunits, respectively, of vacuolar h+-atpases; 52% of the residues of the methanogenic alpha subunit were identical ... | 1989 | 2544575 |
| glycogen-bound polyphosphate kinase from the archaebacterium sulfolobus acidocaldarius. | glycogen-bound polyphosphate kinase has been isolated from a crude extract of sulfolobus acidocaldarius by isopycnic centrifugation in cscl. divalent cations (mn2+ greater than mg2+) stimulated the reaction. the enzyme does not require the presence of histones for its activity; it is inhibited strongly by phosphate and slightly by fluoride. the protein from the glycogen complex migrated in a sodium dodecyl sulfate-polyacrylamide gel as a 57-kilodalton protein band; after isoelectric focusing it ... | 1989 | 2549015 |
| reverse gyrase binding to dna alters the double helix structure and produces single-strand cleavage in the absence of atp. | stoichiometric amounts of pure reverse gyrase, a type i topoisomerase from the archaebacterium sulfolobus acidocaldarius were incubated at 75 degrees c with circular dna containing a single-chain scission. after covalent closure by a thermophilic ligase and removal of bound protein molecules, negatively supercoiled dna was produced. this finding, obtained in the absence of atp, contrasts with the atp-dependent positive supercoiling catalyzed by reverse gyrase and is interpreted as the result of ... | 1989 | 2555155 |
| a novel a-type terminal oxidase from sulfolobus acidocaldarius with cytochrome c oxidase activity. | cytochrome c oxidase was solubilized with a nonionic detergent n-decanoyl-n-methyl glucamide from the membranes of sulfolobus acidocaldarius, a thermoacidophilic archaebacterium, and was purified. the enzyme oxidized horse heart cytochrome c with a vmax of 63 mumols/min/mg at 50 degrees c. the activity was sensitive to cyanide. the enzyme also catalyzed oxygen uptake detergent on n, n, n', n'-tetramethyl p-phenylene diamine. an apparent molecular mass was estimated to be 150 kda. the enzyme is c ... | 1989 | 2558649 |
| purification and characterization of glucose dehydrogenase from the thermoacidophilic archaebacterium thermoplasma acidophilum. | glucose dehydrogenase was purified to homogeneity from the thermoacidophilic archaebacterium thermoplasma acidophilum. the enzyme is a tetramer of polypeptide chain mr 38,000 +/- 3000, it is catalytically active with both nad+ and nadp+ cofactors, and it is thermostable and remarkably resistant to a variety of organic solvents. the amino acid composition was determined and compared with those of the glucose dehydrogenases from the archaebacterium sulfolobus solfataricus and the eubacteria bacill ... | 1989 | 2803257 |
| [isolation and properties of the suai restriction endonuclease from the thermoacidophilic archaebacterium sulfolobus acidocaldarius]. | a new restriction endonuclease suai was isolated from the thermoacidophilic archaebacterium sulfolobus acidocaldarius. the enzyme is an isoschizomer of bspr1; it recognizes tetranucleotide ggcc and cleaves dna in the center of this sequence. suai requires mg2+, the optimal concentration being 6 mm. kcl at concentrations above 25 mm significantly inhibits the enzyme activity. the ph optimum lies within the range of 6--7 at 70 degrees c, the temperature optimum is at 70--75 degrees c. the enzyme i ... | 1987 | 2822145 |
| purification and properties of nadh dehydrogenase from a thermoacidophilic archaebacterium, sulfolobus acidocaldarius. | an nadh dehydrogenase was purified to electrophoretical homogeneity from sulfolobus acidocaldarius, a thermoacidophilic archaebacterium optimally growing at ph 2-3 and 75 degrees c. a 2,100-fold purification was achieved. the purified enzyme is an acidic protein with an isoelectric point of 5.6 and a molecular weight of 95,000, consisting of two 50,000-dalton subunits. the enzyme showed an absorption spectrum characteristic of flavoproteins, with maxima at 272, 372, and 448 nm. the enzyme is hig ... | 1987 | 2822684 |
| analysis of transcription in the archaebacterium sulfolobus indicates that archaebacterial promoters are homologous to eukaryotic pol ii promoters. | the 5'-termini were precisely mapped for five constitutive and one uv-inducible transcript from the sulfolobus virus-like particle ssv1. the comparison of the dna sequences around these transcriptional initiation sites revealed the presence of two conserved sequence elements: a trinucleotide sequence close to the initiation site itself and an at-rich hexanucleotide sequence centered about 26 nucleotides upstream of it. similar dna sequences were found upstream of the transcriptional start sites ... | 1988 | 2829113 |
| reverse gyrase of sulfolobus: purification to homogeneity and characterization. | by using hydrophobic interaction as the first chromatographic stage, we purified to homogeneity reverse gyrase, an atp-dependent dna topoisomerase i, isolated from the thermoacidophilic archaebacterium sulfolobus acidocaldrius. this procedure allowed quick and complete separation of reverse gyrase from nucleases and dna binding proteins present in sulfolobus. the final product was revealed, by sds-page, as a unique band with an apparent molecular mass of 128 kda, and the amino acid composition w ... | 1988 | 2853975 |
| the plasma membrane atpase of the thermoacidophilic archaebacterium sulfolobus acidocaldarius. purification and immunological relationships to f1-atpases. | the plasma-membrane-associated atpase of the thermoacidophilic archaebacterium sulfolobus acidocaldarius characterized in a previous work [m. lübben & g. schäfer (1987) eur. j. biochem. 164, 533-540] has been solubilized. it can be easily removed from the membrane by mild treatment with zwitterionic detergents, therefore it appears to be a peripheral membrane protein analogous to the soluble f1-atpase of eubacteria and eukaryotes. further purification has been achieved by subsequent gel permeati ... | 1987 | 2887427 |
| the halobacterial h+-translocating atp synthase relates to the eukaryotic anion-sensitive h+-atpase. | the h+-translocating atp synthase of halobacterium halobium (y. mukohata and m. yoshida (1987) j. biochem. 102, 797-802) includes a catalytic moiety of 320 kda which is isolated as an azide-insensitive atpase (t. nanba and y. mukohata (1987) j. biochem. 102, 591-598). the polyclonal antibody against this archaebacterial atpase cross-reacts with the anion-sensitive h+-atpase of red beet, beta vulgaris, tonoplast as well as with another archaebacterial atpase from sulfolobus acidocaldarius. the af ... | 1987 | 2892466 |
| the membrane-associated atpase from sulfolobus acidocaldarius is distantly related to f1-atpase as assessed from the primary structure of its alpha-subunit. | isolation of novel membrane-associated atpases, presumably soluble parts of the h+-atpases, from archaebacteria has been recently reported, and their properties were found to be significantly different from the usual f1-atpase. in order to assess the relationship of the archaebacterial atpases to the f1-atpases and other known atpases, the amino acid sequence of the alpha subunit of the atpase from sulfolobus acidocaldarius, an acidothermophilic archaebacterium, was compared with the sequences o ... | 1988 | 2896191 |
| molecular cloning of the beta-subunit of a possible non-f0f1 type atp synthase from the acidothermophilic archaebacterium, sulfolobus acidocaldarius. | the gene which encodes the beta subunit of the novel membrane-associated atpase has been identified and characterized. the beta subunit, which is most likely the soluble part of the non-f0f1 type h+-atpase, was obtained from the archaebacterium, sulfolobus acidocaldarius. in terms of its location, it follows just after the gene for its alpha subunit. it is comprised of 1398 nucleotides, corresponding to a protein of 465 amino acids, and the consensus sequence in the nucleotide binding proteins i ... | 1988 | 2903160 |
| cdna sequence and homologies of the "57-kda" nucleotide-binding subunit of the vacuolar atpase from arabidopsis. | functional and structural similarities among a wide variety of endomembrane h+-atpases suggest that they form a distinct class with a common origin. immunological studies (manolson, m. f., percy, j. m., apps, d. k., xie, x. s., stone, d. k., and poole, r. j. (1987) in proceedings of the membrane protein symposium (goheen, s. c., ed) pp. 427-434, bio-rad, richmond, ca, and m. f. manolson, j. m. percy, d. k. apps, x. s. xie, d. k. stone, m. harrison, d. j. clarke, r. j. poole, unpublished data) su ... | 1988 | 2903860 |
| archaebacterial atpase: studies on subunit composition and quaternary structure of the f1-analogous atpase from sulfolobus acidocaldarius. | a modified procedure for the purification of soluble atpase from the thermoacidophilic archaebacterium sulfolobus acidocaldarius is described. in addition to (alpha) 65 and (beta) 51 kda polypeptides, further subunits gamma * (20 kda) and delta * (12 kda) are demonstrated to be components of the enzyme, exhibiting a total molecular mass of 380 kda. molecular electron microscopic images of the native enzyme indicate a quaternary structure probably formed by the gamma *, delta *-complex as a centr ... | 1988 | 2907729 |
| a plasma-membrane associated atpase from the thermoacidophilic archaebacterium sulfolobus acidocaldarius. | thermoacidophilic archaebacteria have gained much interest because of their phylogenetic distance to eubacteria and eukaryotes and also because of their unique living conditions. investigation of the energy-converting system therefore offers a key for understanding the evolutionary position and environmental adaptation of these unusual bacteria. a plasma-membrane-associated adenosine triphosphatase with specific activities of 0.3-0.6 mumol min-1 (mg protein)-1 has been detected in the thermoacid ... | 1987 | 2952501 |
| purification and properties of the atpase solubilized from membranes of an acidothermophilic archaebacterium, sulfolobus acidocaldarius. | a novel atpase was solubilized from membranes of an acidothermophilic archaebacterium, sulfolobus acidocaldarius, with low ionic strength buffer containing edta. the enzyme was purified to homogeneity by hydrophobic chromatography and gel filtration. the molecular weight of the purified enzyme was estimated to be 360,000. polyacrylamide gel electrophoresis of the purified enzyme in the presence of sodium dodecyl sulfate revealed that it consisted of three kinds of subunits, alpha, beta, and gamm ... | 1987 | 2966145 |
| plasmid-related anaerobic autotrophy of the novel archaebacterium sulfolobus ambivalens. | three different species of the genus sulfolobus, s. acidocaldarius, s. solfataricus (= caldariella) and s. brierleyi, have been distinguished by the conditions required for optimal growth, by the component patterns of their dna-dependent rna polymerases and by dna sequence data. many isolates of these species are able to grow chemolithoautotrophically using co2 as the sole carbon source and the oxidation of s(0) with o2 yielding sulphuric acid, as the energy source, though a few others grow only ... | 1985 | 2983223 |
| archaebacterial malate dehydrogenases. the enzymes from the thermoacidophilic organisms sulfolobus acidocaldarius and thermoplasma acidophilum show a-side stereospecificity for nad+. | the stereoselective transfer of hydrogen from nadh to oxaloacetate catalysed by malate dehydrogenases (ec 1.1.1.37) from the thermoacidophilic archaebacteria sulfolobus acidocaldarius and thermoplasma acidophilum was studied by the p.m.r. method described by zhou & wong [(1981) j. biochem. biophys. methods 4, 329-338]. both enzymes are a-side (pro-r) stereospecific for nadh. | 1985 | 2985051 |
| a restriction endonuclease suai from the thermoacidophilic archaebacterium sulfolobus acidocaldarius. | a type ii restriction endonuclease (suai) has been isolated from the thermoacidophilic archaebacterium sulfolobus acidocaldarius. the enzyme is an isoschizomer of bspri. it does not cut s. acidocaldarius dna, as the recognition sequence ggcc in this dna contains modified nucleotide(s). the enzyme is most active at 60-70 degrees c and is highly thermostable. | 1985 | 2996942 |
| intrinsic dna-dependent atpase activity of reverse gyrase. | reverse gyrase is a type i dna topoisomerase that promotes positive supercoiling of closed-circular double-stranded dna through an atp-dependent reaction, and it was purified from an archaebacterium, sulfolobus. when atp is replaced by utp, gtp, or ctp, this enzyme just relaxes the negatively supercoiled closed-circular double-stranded dna. we found that reverse gyrase hydrolyzes atp through a double-stranded dna-dependent reaction. the superhelicity of the dna did not affect the atpase activity ... | 1987 | 3038879 |
| putative promoter elements for the ribosomal rna genes of the thermoacidophilic archaebacterium sulfolobus sp. strain b12. | in sulfolobus sp. strain b12, single-copy genes encode the three ribosomal rnas. the genes for the 16s rrna and for the 23s rrna are closely linked but separated from the 5s rrna gene. transcription of the 16s/23s rrna gene cluster starts 139 nucleotides upstream of the 5'-end of mature 16s rrna. for the 5s rrna gene the point of transcription initiation coincides with the 5'-end of mature 5s rrna. the comparison of the upstream regions for these transcriptional start sites shows the presence of ... | 1987 | 3039462 |
| total reconstitution of active large ribosomal subunits of the thermoacidophilic archaebacterium sulfolobus solfataricus. | the large ribosomal subunit of the extremely thermoacidophilic archaebacterium sulfolobus solfataricus has been reconstituted from the completely dissociated rna and proteins by a two-step incubation procedure at high temperatures. successful reconstitution requires a preliminary incubation of the ribosomal components for 45 min at 65 degrees c, followed by a second heat-treatment at 80 degrees c for 60 min. structural reassembly depends upon high concentrations of k+ (300-400 mm) and mg2+ (20-4 ... | 1986 | 3083401 |
| quinones from archaebacteria, ii. different types of quinones from sulphur-dependent archaebacteria. | from the sulphur-dependent, anaerobically grown archaebacterium sulfolobus ambivalens caldariella quinone, cq-6(12h) and the new sulfolobus quinone sq-6(12h), 6-(3,7,11,15,19,23-hexamethyltetracosyl)-5-methyl-benz[b]thioph en-4, 7-quinone have been isolated as main components. lower homologues sq-5-(10h), sq-4(8h), sq-3(6h), phylloquinone-like species cq-6(10h), sq-6(10h) and the menaquinone mk-6(12h) are present as minor components. the results are compared with those from sulfolobus acidocalda ... | 1986 | 3085688 |
| differential features of ribosomes and of poly(u)-programmed cell-free systems derived from sulphur-dependent archaebacterial species. | the properties of poly(u)-directed cell-free systems developed from the sulphur-dependent, thermophilic archaebacteria desulfurococcus mobilis, thermoproteus tenax, sulfolobus solfataricus, thermococcus celer and thermoplasma acidophilum have been compared. all systems are truly thermophilic in requiring incubation at temperatures close to the physiological optimum for cell growth. under optimized conditions the error frequency in trna selection is less than 0.4% at 80 degrees c, and synthetic e ... | 1986 | 3087750 |
| archaebacterial and eukaryotic ribosomal subunits can form active hybrid ribosomes. | purified ribosomal subunits from the extremely thermoacidophilic archaebacterium sulfolobus solfataricus are able to recognize ribosomal subunits from the yeast saccharomyces cerevisiae forming hybrid monosomes that can be revealed by sucrose gradient analysis and are active in peptide bond formation. both reciprocal combinations (archaebacterial 30 s + eukaryotic 60 s and archaebacterial 50 s + eukaryotic 40 s) are functional. in contrast, no hybrid couples are formed between subunits of yeast ... | 1986 | 3091397 |
| occurrence of coenzyme f420 and its gamma-monoglutamyl derivative in nonmethanogenic archaebacteria. | analysis of the fluorescent compounds extracted from six different species of halobacteria and one species each of sulfolobus and thermoplasma revealed the universal occurrence of coenzyme f420, (n-[n-[o-[5-(8-hydroxy-5-deazaisoalloxazin-10-yl)-2,3,4-trihydroxy -4-pentoxyhydroxyphosphinyl]-l-lactyl]-l-gamma-glutamyl]-l -glutamic acid), or its gamma-monoglutamyl derivative or both. the total amount (approximately 100 pmol/mg [dry weight]) of these compounds found in the halobacteria studied was a ... | 1986 | 3093465 |
| 1h and 13c nmr assignment of benzothiophenquinones from the sulfur-oxidizing archaebacterium sulfolobus solfataricus. | from sulfolobus solfataricus, a sulfur-oxidizing thermophilic member of archaebacteria, three unusual benzothiophenquinones were isolated. detailed nmr studies on these quinones, including multipulse mono-dimensional and two-dimensional techniques, were performed to obtain carbon and proton assignments, one-bond, geminal and vicinal coupling constants and t1 relaxation times. this report extends the known quinone composition of thermophilic archaebacteria and further supports the concept that th ... | 1986 | 3095114 |
| purification and characterization of propylamine transferase from sulfolobus solfataricus, an extreme thermophilic archaebacterium. | the enzyme propylamine transferase, catalyzing the transfer of the propylamine moiety from s-adenosyl(5')-3-methylthiopropylamine to several amine acceptors, has been purified 643-fold in 20% yield from sulfolobus solfataricus, an extreme thermophilic archaebacterium optimally growing at 87 degrees c. the purified enzyme (specific activity 2.05 units/mg protein), is homogeneous by criteria of gel electrophoresis, gel filtration, isoelectric focusing and ultracentrifugation analysis. the molecula ... | 1986 | 3096734 |
| structure determination of a new fluorescent tricyclic nucleoside from archaebacterial trna. | a highly fluorescent nucleoside was detected in enzymatic digests of the extremely thermophilic archaebacterium sulfolobus solfataricus by combined liquid chromatography-mass spectrometry (lc/ms). following isolation, the structure was determined primarily by mass spectrometry, to be 3-(beta-d-ribofuranosyl)-4,9-dihydro-4,6,7-trimethyl-9-oxoimidazo[ 1, 2-a]purine (mimg), a new derivative of the y (wye) nucleoside. the structural assignment was verified by comparison of the base released by acid ... | 1987 | 3103099 |
| malic enzyme from archaebacterium sulfolobus solfataricus. purification, structure, and kinetic properties. | an nadp-preferring malic enzyme ((s)-malate:nadp oxidoreductase (oxalacetate-decarboxylating) ec 1.1.1.40) with a specific activity of 36.6 units per mg of protein at 60 degrees c and an isoelectric point of 5.1 was purified to homogeneity from the thermoacidophilic archaebacterium sulfolobus solfataricus, strain mt-4. the purification procedure employed ion exchange chromatography, ammonium sulfate fractionation, affinity chromatography, and gel filtration. molecular weight determinations demon ... | 1987 | 3108257 |
| crystalline nad/nadp-dependent malate dehydrogenase; the enzyme from the thermoacidophilic archaebacterium sulfolobus acidocaldarius. | malate dehydrogenase from sulfolobus acidocaldarius has been purified 240-fold to apparent electrophoretic homogeneity. the enzyme shows a specific activity of 277 u/mg and crystallizes readily. the relative molecular mass of the native enzyme is estimated as 128,500 by ultracentrifugation. after cross-linking a relative molecular mass of 134,000 is found by sodium dodecyl sulfate gel electrophoresis. malate dehydrogenase from s. acidocaldarius is composed of four subunits of identical size with ... | 1987 | 3109450 |
| a novel archaebacterial nad+-dependent alcohol dehydrogenase. purification and properties. | an nad+-dependent alcohol dehydrogenase (alcohol: nad+ oxidoreductase, ec 1.1.1.1) was detected in cellular extracts of the extreme thermophilic archaebacterium sulfolobus solfataricus. the enzyme was purified to homogeneity and shown to be a dimer with a native molecular mass of 71 kda by sucrose gradient centrifugation and sds electrophoresis. the enzyme has a broad substrate specificity that includes linear and branched primary alcohols, linear and cyclic secondary alcohols, linear and cyclic ... | 1987 | 3115775 |
| the genome of the thermoacidophilic archaebacterium sulfolobus acidocaldarius does not contain repetitive sequences. | characteristics of genome organization in the sulfur-dependent thermoacidophilic archaebacterium sulfolobus acidocaldarius have been studied. by means of hybridization analysis it is shown that the genome of s. acidocaldarius, unlike the genome of the extremely halophilic archaebacterium halobacterium halobium, does not contain repetitive sequences. | 1987 | 3118185 |
| indole-3-acetic acid and 2-(indol-3-ylmethyl)indol-3-yl acetic acid in the thermophilic archaebacterium sulfolobus acidocaldarius. | indole-3-acetic acid (iaa) and 2-(indol-3-ylmethyl)indol-3-yl acetic acid were identified in lipid extracts of sulfolobus acidocaldarius; they occurred at concentrations of 0.57 and 0.59 mumol/g (dry weight), respectively. the amount of iaa found in these cells is more than a thousand times greater than that found in a typical extract of a plant in which iaa serves as a plant growth hormone. neither of these compounds was detected in the other archaebacteria that were analyzed; these included su ... | 1987 | 3119573 |
| structure of solfapterin (erythro-neopterin-3'-d-2-deoxy-2-aminoglucopyranoside) isolated from the thermophilic archaebacterium sulfolobus solfataricus. | the structure of the major fluorescent pterin present in thermophilic archaebacterium sulfolobus solfataricus has been assigned, by analysis of the intact molecule and its hydrolytic and periodate cleavage products, as erythro-neopterin-3'-d-2-deoxy-2-aminoglucopyranoside. the trivial name solfapterin is proposed for this compound. | 1988 | 3125154 |
| purification and characterization of a heat-stable esterase from the thermoacidophilic archaebacterium sulfolobus acidocaldarius. | a heat-stable esterase has been purified 1080-fold to electrophoretic homogeneity from sulfolobus acidocaldarius, a thermoacidophilic archaebacterium; 20% of the starting activity is recovered. the purified enzyme shows a specific activity of 158 units/mg, based on the hydrolysis of p-nitrophenyl acetate. the esterase hydrolyses short-chain p-nitrophenyl esters, aliphatic esters and triacylglycerols. it is strongly inhibited by paraoxon and phenylmethanesulphonyl fluoride, but only weakly by ese ... | 1988 | 3128284 |
| transcription termination in the archaebacterium sulfolobus: signal structures and linkage to transcription initiation. | the precise map positions were determined for the 3'-termini of five transcripts of the sulfolobus virus-like particle ssv1. in all cases analyzed, these 3'-termini mapped immediately downstream of a sequence tttttyt which was part of a pyrimidine-rich region of 16-19 nucleotides length. no correlation was evident between the position of the 3'-termini and possible secondary structures within the rna. in two cases, the 3'-termini of ssv1 transcripts mapped in the immediate vicinity of transcript ... | 1988 | 3129698 |
| purification and properties of an archaebacterial enzyme: citrate synthase from sulfolobus solfataricus. | citrate synthase from the thermoacidophilic archaebacterium sulfolobus solfataricus was purified to homogeneity. the synthase is a dimer composed of subunits of mr approximately equal to 40,000. the km values of acetyl-coa and oxalacetate are 7 microm and 20 microm, respectively. nadh (ki = 3.5mm) and atp (ki = 0.36mm) are competitive inhibitors vs acetyl-coa. the dimeric structure and the inhibition by nucleotides (atp greater than nadh) correlate the archaebacterial enzyme to synthases from eu ... | 1988 | 3130075 |
| microsequence analysis of dna-binding proteins 7a, 7b, and 7e from the archaebacterium sulfolobus acidocaldarius. | dna-binding proteins in eubacteria, such as escherichia coli ns1 and ns2, are generally small basic molecules. in contrast, the archaebacterium sulfolobus acidocaldarius contains three groups of dna-binding proteins which have molecular masses of 7, 8, and 10 kda. in the first group, five proteins (7a-7e) have been identified, while in the second and third group only two proteins each are present, denoted 8a and 8b and 10a and 10b, respectively. in this paper, we present the primary structures o ... | 1988 | 3130377 |
| characteristic views of prokaryotic 50s ribosomal subunits. | multivariate statistical analysis and classification techniques are powerful tools in sorting noisy electron micrographs of single particles according to their principal features, enabling one to form average images with an enhanced signal-to-noise ratio and a better reproducible resolution. we apply this methodology here to determining the characteristic views of the large (50s) ribosomal subunits from the eubacterium escherichia coli and the archaebacteria methanococcus vannielii, sulfolobus s ... | 1987 | 3131536 |
| isolation, characterization and microsequence analysis of a small basic methylated dna-binding protein from the archaebacterium, sulfolobus solfataricus. | dna-binding proteins have been extracted from the thermoacidophilic archaebacterium sulfolobus solfataricus strain p1, grown at 86 degrees c and ph 4.5. these proteins, which may have a histone-like function, were isolated and purified under standard, non-denaturing conditions, and can be grouped into three molecular mass classes of 7, 8 and 10 kda. we have purified to homogenity the main 7 kda protein and determined its dna-binding affinity by filter binding assays and electron microscopy. the ... | 1988 | 3132977 |
| rna polymerase subunit homology among cyanobacteria, other eubacteria and archaebacteria. | rna polymerase purified from vegetative cells of the cyanobacterium anabaena sp. strain pcc 7120 contains a dissociable sigma factor and a core of five subunits: the beta', beta, and two alpha subunits characteristic of all eubacteria and an additional 66,000-molecular-weight polypeptide called gamma. fifteen of fifteen strains of unicellular and filamentous cyanobacteria tested contained a serologically related gamma protein. antiserum to gamma reacted with escherichia coli beta' and the a subu ... | 1988 | 3137214 |
| vitamin contents of archaebacteria. | the levels of six water-soluble vitamins of seven archaebacterial species were determined and compared with the levels found in a eubacterium, escherichia coli. biotin, riboflavin, pantothenic acid, nicotinic acid, pyridoxine, and lipoic acid contents of halobacterium volcanii, methanobacterium thermoautotrophicum delta h, "archaeoglobus fulgidus" vc-16, thermococcus celer, pyrodictium occultum, thermoproteus tenax, and sulfolobus solfataricus were measured by using bioassays. the archaebacteria ... | 1988 | 3137215 |
| folic acid and pteroylpolyglutamate contents of archaebacteria. | cell extracts of methanogens and the thermoacidophile sulfolobus solfataricus contained little or no folic acid (pteroylglutamate) or pteroylpolyglutamate activity (less than 0.1 nmol/g [dry weight]). however, the halophile halobacterium salinarum contained pteroylmono- or pteroyldiglutamates, and halobacterium volcanii and halobacterium halobium contained pteroyltriglutamates at levels equivalent to those in eubacteria (greater than 1 nmol/g [dry weight]). | 1988 | 3137217 |