| distribution of delta-aminolevulinic acid biosynthetic pathways among phototrophic bacterial groups. | two biosynthetic pathways are known for the universal tetrapyrrole precursor, delta-aminolevulinic acid (ala). in the ala synthase pathway which was first described in animal and some bacterial cells, the pyridoxal phosphate-dependent enzyme ala synthase catalyzes condensation of glycine and succinyl-coa to form ala with the loss of c-1 of glycine as co2. in the five-carbon pathway which was first described in plant and algal cells, the carbon skeleton of glutamate is converted intact to ala in ... | 1989 | 2789025 |
| on the anomalous temperature behaviour of the epr signal of monovalent nickel in hydrogenase. | the dependence on temperature in the range between 4.2 k and 20 k was measured for the epr signal of monovalent nickel in h2-reduced hydrogenase from chromatium vinosum and from methanobacterium thermoautotrophicum. in accordance with measurements on the hydrogenase from desulfovibrio gigas [teixeira, m., moura, i., xavier, a. v., huynh, b. h., dervartanian, d. v., peck, h. d., jr, legall, j. and moura, j. j. g. (1985) j. biol. chem. 260, 8942-8950; and cammack, r., patil, d. s. and fernandez, v ... | 1987 | 2826142 |
| interaction, functional relations and evolution of large and small subunits in rubisco from prokaryota and eukaryota. | in early biological evolution anoxygenic photosynthetic bacteria may have been established through the acquisition of ribulose bisphosphate carboxylase-oxygenase (rubisco). the establishment of cyanobacteria may have followed and led to the production of atmospheric oxygen. it has been postulated that a unicellular cyanobacterium evolved to cyanelles which were evolutionary precursors of chloroplasts of both green and non-green algae. the latter probably diverged from ancestors of green algae as ... | 1986 | 2878448 |
| chromatium flavocytochrome c: kinetics of reduction of the heme subunit, and the flavocytochrome c-mitochondrial cytochrome c complex. | the kinetics of reduction of chromatium vinosum flavocytochrome c heme subunit by exogenous flavin neutral semiquinones generated by laser flash photolysis have been investigated. unlike the holoprotein, the isolated heme subunit was appreciably reactive with lumiflavin neutral semiquinone. the measured rate constant for the reaction (2.7 x 10(7) m-1 s-1) was comparable to those of c-type cytochromes having similar redox potentials. the ionic strength dependence of the reaction with fmn neutral ... | 1985 | 2981511 |
| monovalent nickel in hydrogenase from chromatium vinosum. light sensitivity and evidence for direct interaction with hydrogen. | redox titrations with hydrogenase from chromatium vinosum show that its nickel ion can exist in 3, possibly 4, different redox states: the 3+, 2+, 1+ and possibly a zero valent state. the 1+ state is unstable: oxidation to ni(ii) occurs unless h2 gas is present. the ni(i) coordination, but not that of ni(iii), is highly light sensitive. a photoreaction occurs on illumination. it is irreversible below 77 k, but reversible at 200 k. the rate of this photodissociation reaction in 2h2o is nearly 6-t ... | 1985 | 2981705 |
| flavocytochromes c: transient kinetics of photoreduction by flavin analogues. | kinetics of reduction of phototrophic bacterial flavocytochromes c by exogenous flavin semiquinones and fully reduced flavins generated by laser flash photolysis have been studied. the mechanisms of reduction of chromatium and chlorobium flavocytochromes c are more similar to one another than previously thought. neither protein is very reactive with neutral flavin semiquinones (k less than 10(7) m-1 s-1), and the reactions with fully reduced flavins are slower than expected on the basis of compa ... | 1985 | 2985110 |
| the use of electron-paramagnetic-resonance spectroscopy to establish the properties of nickel and the iron-sulphur cluster in hydrogenase from chromatium vinosum. | | 1985 | 2993066 |
| electron-paramagnetic-resonance studies on the spatial relationship of redox components in cytochrome oxidase. | | 1985 | 2993072 |
| binding of cyanide to cytochrome c' from chromatium vinosum. | spectroscopic evidence is presented which demonstrates the binding of cyanide to the ferric cytochrome c' from chromatium vinosum. the cytochrome was shown to bind one equivalent of cyanide with an equilibrium constant of 2.1 x 10(4) at ph 7.0 and 25 degrees c. this finding represents the first observation of the binding of an anionic ligand to the heme iron in a ferric cytochrome c'. these results suggest that the binding site of the ferric chromatium cytochrome c' may be significantly more acc ... | 1985 | 2994739 |
| expression of genes for subunits of plant-type rubisco from chromatium and production of the enzymically active molecule in escherichia coli. | a dna fragment containing genes for both large (a) and small (b) subunits of ribulose-1,5-bisphosphate carboxylase/oxygenase (rubisco) from a photosynthetic bacterium chromatium vinosum was ligated with vectors for expressing unfused proteins and introduced into cells of escherichia coli. the expressers of rubisco were screened on agar plates using the specific antibody raised against the native enzyme from chromatium. the production of both subunits a and b in the expressers was demonstrated by ... | 1985 | 2998871 |
| complex formation and electron transfer between mitochondrial cytochrome c and flavocytochrome c552 from chromatium vinosum. | flavocytochrome c552 from chromatium vinosum catalyzes the oxidation of sulfide to sulfur using a soluble c-type cytochrome as an electron acceptor. mitochondrial cytochrome c forms a stable complex with flavocytochrome c552 and may function as an alternative electron acceptor in vitro. the recognition site for flavocytochrome c552 on equine cytochrome c has been deduced by differential chemical modification of cytochrome c in the presence and absence of flavocytochrome c552 and by kinetic analy ... | 1986 | 3001047 |
| the use of a water-soluble carbodiimide to study the interaction between chromatium vinosum flavocytochrome c-552 and cytochrome c. | the interaction between horse heart cytochrome c and chromatium vinosum flavocytochrome c-552 was studied using the water-soluble reagent 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (edc). treatment of flavocytochrome c-552 with edc was found to inhibit the sulfide: cytochrome c reductase activity of the enzyme. sds gel electrophoresis studies revealed that edc treatment led to modification of carboxyl groups in both the mr 21 000 heme peptide and the mr 46 000 flavin peptide, and also to the ... | 1986 | 3002455 |
| ligand-controlled dissociation of chromatium vinosum cytochrome c'. | carbon monoxide binding to chromatium vinosum ferrocytochrome c' has been studied by high-precision equilibrium methods. in contrast to the co binding properties of rhodospirillum molischianum cytochrome c' [doyle, m. l., weber, p. c., & gill, s. j. (1985) biochemistry 24, 1987-1991], co binding to c. vinosum cytochrome c' is found to be unusual in the following ways. the binding curve is found to be cooperative with typical hill coefficients equal to 1.25. the shape of the binding curve is asym ... | 1986 | 3013306 |
| hydrogenases of phototrophic microorganisms. | this review surveys recent work done in the laboratory of the author and related laboratories on the properties and possible practical applications of hydrogenases of phototrophic microorganisms. homogeneous hydrogenase preparations were obtained from purple non-sulfur (rhodospirillum rubrum s1, rhodobacter capsulatus b10) and purple sulfur (chromatium vinosum d, thiocapsa roseopersicina bbs) bacteria, and from the green sulfur bacterium chlorobium limicola forma thiosulfatophilum l; highly puri ... | 1986 | 3015244 |
| the redox properties of the iron-sulphur cluster in hydrogenase from chromatium vinosum, strain d. | the midpoint potentials of the changes in the electron spin resonance (esr) spectra in the region of g = 2 in hydrogenase ii from chromatium vinosum were estimated by redox titrations. as the enzyme was progressively reduced, the g = 2.02 signal increased, while the satellite lines at g = 1.98 etc. decreased. at still lower potentials the signal at g = 2.02 decreased. the midpoint potentials of the two processes were estimated to be + 100 mv and - 20 mv, respectively, at ph 8.5. the first potent ... | 1986 | 3015252 |
| spectroscopic and kinetic properties of an oxygen-binding heme protein from chromatium vinosum. | resonance raman and electron paramagnetic resonance spectroscopy have been utilized to identify histidine as an axial heme ligand in a high spin, heme c-containing protein isolated from the photosynthetic purple sulfur bacterium chromatium vinosum. resonance raman spectroscopy has also been used to characterize the co adduct of the c. vinosum hemoprotein. resonance raman spectra of the heme site obtained within 10 ns of co photolysis from the ferrous hemoprotein are virtually identical to those ... | 1987 | 3027081 |
| role of the small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase in the activation process. | the large (a) and small (b) subunits of ribulose-1,5-bisphosphate carboxylase/oxygenase (ec 4.1.1.39) from the cyanobacterium aphanothece halophytica and from the purple sulfur photosynthetic bacterium chromatium vinosum (strain d) were separated by sucrose density gradient centrifugation at low ionic strength and alkaline ph (9.3), respectively. it was found that subunit b enhances the extent of activation by co2 and mg2+ at equilibrium of the two homologous enzymes consisting of aphanothece la ... | 1986 | 3089168 |
| ciliates from a fresh water sulfuretum. | ciliates were collected from a freshwater sulfuretum, lake cisó, which is part of a gypsum karstic area whose main feature is lake banyoles (girona, spain). chromatium, lamprocystis and chlorobium are the major phototrophic sulfur bacteria in lake cisó. blooms of a photosynthetic cryptomonad (up to 5 x 10(5) ind ml-1) were found at the metalimnion. the community of ciliates could be divided in three groups: aerobic, cosmopolitan, genera such as stentor and vorticella, in the epilimnion; a large ... | 1986 | 3089342 |
| [effect of pesticides on bacterial membranes]. | the effect of pure preparation of ordram, fosalon, ddt, methoxychlorine, hydrel, dihydrel, 2,4-d, 2m-4c and of technical preparations of saturn, linuron, ronstar and keltan on the membrane functions (respiration and motility) of azospirillum brasilense and chromatium minutissimum cells and on malate and nadh oxidation by the isolated membranes of micrococcus lysodeikticus was investigated. the effect varied from irreversible impairment to undetectable impairment of the measured activities depend ... | 1987 | 3112764 |
| lysine and arginine transport in the photosynthetic bacterium chromatium vinosum. | the photosynthetic purple sulfur bacterium chromatium vinosum can take up both arginine and lysine in the light and, to a lesser extent, in the dark. competitive inhibition experiments suggest the likely presence of two transport systems in this bacterium: one capable of transporting either lysine or arginine and a second capable of transporting arginine but not lysine. uptake of both amino acids is electrogenic and appears to involve the cotransport of neither protons nor sodium ions. it is sug ... | 1988 | 3124743 |
| thioredoxin from rhodospirillum rubrum: primary structure and relation to thioredoxins from other photosynthetic bacteria. | thioredoxin was isolated from a photosynthetic purple nonsulfur bacterium, rhodospirillum rubrum, and its primary structure was determined by high-performance tandem mass spectrometry. the sequence identity of r. rubrum thioredoxin to escherichia coli thioredoxin was intermediate to those of the chlorobium thiosulfatophilum and chromatium vinosum proteins. the results indicate that r. rubrum has an nadp-thioredoxin system similar to that of other photosynthetic purple bacteria. | 1988 | 3129411 |
| transcriptional regulation of genes for plant-type ribulose-1,5-bisphosphate carboxylase/oxygenase in the photosynthetic bacterium, chromatium vinosum. | the content of ribulose-1,5-bisphosphate carboxylase/oxygenase (rubisco) in the photosynthetic purple sulfur bacterium, chromatium vinosum, grown either heterotrophically or autotrophically, was highly correlated with the level of 2.0-kb mrna encoding genes for both large (rbcl) and small (rbcs) subunits. this result indicates the transcriptional regulation of rubisco biosynthesis in chromatium cells. in the analysis of transcripts for rbcl and rbcs in escherichia coli transformed by a plasmid b ... | 1988 | 3286254 |
| [results of the storage of freeze dried microbial cultures for 25 years]. | saprophytic microorganisms belonging to different physiological groups (azotobacter, acetic, ammonifying, lactic and nodule bacteria, a phototrophous purple bacterium of the chromatium genus, bacteria of the micrococcus and pseudomonas genera, and a yeast of the candida genus) were stored at 3-6 degrees c for 25 years in the freeze-dried state. all of the strains were found to be viable after the storage. the number of viable cells decreased for some bacteria, but to a far less degree than when ... | 1987 | 3309582 |
| properties of the reaction center of the thermophilic purple photosynthetic bacterium chromatium tepidum. | reaction centers were purified from the thermophilic purple sulfur photosynthetic bacterium chromatium tepidum. the reaction center consists of four polypeptides l, m, h and c, whose apparent molecular masses were determined to be 25, 30, 34 and 44 kda, respectively, by polyacrylamide gel electrophoresis. the heaviest peptide corresponds to tightly bound cytochrome. the tightly bound cytochrome c contains two types of heme, high-potential c-556 and low-potential c-553. the low-potential heme is ... | 1987 | 3318928 |
| a homolog of ribulose bisphosphate carboxylase/oxygenase-binding protein in chromatium vinosum. | a 700-kda protein composed of 12 apparently identical 60-kda subunits copurifies with the l8s8 form of ribulose bisphosphate carboxylase/oxygenase (rubisco) from chromatium vinosum. chromatography on deae-sephadex a-50 separates the two proteins in pure form. on the basis of the highly reproducible copurification and reaction of the 700-kda protein with antibodies to pea rubisco large (l)-subunit-binding protein, the protein from c. vinosum is designated as a putative binding protein (pbp) for r ... | 1988 | 3341773 |
| spectroscopic and ligand-binding properties of an oxygen-binding heme protein from chromatium vinosum. | magnetic circular dichroism spectra were obtained for the oxidized and reduced forms of cyanide, azide and carbon monoxide complexes of an o2-binding hemeprotein isolated from the photosynthetic purple sulfur bacterium, chronatium vinosum. cyanide binding to the protein, which results in formation of a low-spin complex, was highly ph dependent with little complex formation observed at ph values near or below 7. | 1988 | 3355839 |
| lipopolysaccharides of thiocystis violacea, thiocapsa pfennigii, and chromatium tepidum, species of the family chromatiaceae. | the lipopolysaccharides (lps) of three species of purple sulfur bacteria (chromatiaceae), thiocystis violacea, thiocapsa pfennigii, and the moderately thermophilic bacterium chromatium tepidum, were isolated. the lps of thiocystis violacea and chromatium tepidum contained typical o-specific sugars, indicating o-chains. long o-chains were confirmed for these species by sodium deoxycholate gel electrophoresis of their lps. thiocapsa pfennigii, however, had short or no o-chains. the core region of ... | 1988 | 3384808 |
| the primary structure of thioredoxin from chromatium vinosum determined by high-performance tandem mass spectrometry. | the primary structure of thioredoxin, a redox protein isolated from chromatium vinosum, was determined by high-performance tandem mass spectrometry, which permitted sequencing of the 14 peptides (ranging in length from 2 to 18 amino acids) generated by digestion with trypsin and of several peptides produced by staphylococcus aureus protease. the mass spectrometrically determined molecular weights of the peptides from the latter digest were used to properly align the tryptic peptides, which could ... | 1987 | 3567166 |
| the nature of l8 and l8s8 forms of ribulose bisphosphate carboxylase/oxygenase from chromatium vinosum. | l8 and l8s8 forms of ribulose bisphosphate carboxylase/oxygenase (rubisco) have been prepared from chromatium vinosum by the extremely mild method of centrifugal fractionation. only the l8s8 form is detectable in crude extracts of this organism. both forms show immunological identify in double diffusion studies using antibody to l subunits of the l8s8 form. l subunits from both l8 and l8s8 enzymes are identical by the criteria of peptides observed after limited proteolysis and n-terminal sequenc ... | 1987 | 3579306 |
| preliminary crystallographic study of a ribulose-1,5-bisphosphate carboxylase-oxygenase from chromatium vinosum. | crystals of a ribulose-1,5-bisphosphate carboxylase-oxygenase from chromatium vinosum were obtained with the hanging-drop vapor diffusion technique, using polyethylene glycol 4000 as precipitant. the crystal belongs to the cubic system, space group i432, with unit cell dimension a = 245.9 a. an asymmetric unit includes one-quarter (l2s2, l: large subunit, s: small subunit) of a hexadecameric molecule (l8s8, 544,000 mr), which is located on the crystallographic point symmetry 222 or 4. the crysta ... | 1986 | 3820296 |
| regulation of nitrogenase activity by covalent modification in chromatium vinosum. | nitrogenase in chromatium vinosum was rapidly, but reversibly inhibited by nh4+. activity of the fe protein component of nitrogenase required both mn2+ and activating enzyme. activating enzyme from rhodospirillum rubrum could replace chromatium chromatophores in activating the chromatium fe protein, and conversely, a protein fraction prepared from chromatium chromatophores was effective in activating r. rubrum fe protein. inactive chromatium fe protein contained a peptide covalently modified by ... | 1985 | 3857878 |
| magnetic susceptibility of hydrogenase from desulfovibrio vulgaris. | magnetization and magnetic susceptibility measurements revealed that the hydrogenase [ec 1.12.2.1] from desulfovibrio vulgaris miyazaki f has an independent unpaired electron in its iron-sulfur cluster. the paramagnetic center of the desulfovibrio hydrogenase is, therefore, different from that in the chromatium hydrogenase which interacts with another paramagnetic center, probably nickel. | 1985 | 3897216 |
| mathematical model for determining the effects of intracytoplasmic inclusions on volume and density of microorganisms. | procaryotic microorganisms accumulate several polymers in the form of intracellular inclusions as a strategy to increase survival in a changing environment. such inclusions avoid osmotic pressure increases by tightly packaging certain macromolecules into the inclusion. in the present paper, a model describing changes in volume and density of the microbial cell as a function of the weight of the macromolecule forming the inclusion is derived from simple theoretical principles. the model is then t ... | 1985 | 3902798 |
| subunit dissociation and reconstitution of ribulose-1,5-bisphosphate carboxylase from chromatium vinosum. | the large and small subunits of ribulose bisphosphate carboxylase from chromatium vinosum were dissociated and separated at ph 9.6 by sucrose density gradient centrifugation. after further purification by gel filtration, the small subunit fraction contained no carboxylase activity. the large subunit fraction was highly depleted of small subunit based on analysis by denaturing polyacrylamide gel electrophoresis. carboxylase activity of the large subunit fraction was approximately 1% of the untrea ... | 1985 | 3918498 |
| heterologous hybridization of ribulose 1,5-bisphosphate carboxylase/oxygenase (rubisco) restores the enzyme activities. | the catalytic core (a8) and small subunit (b) of ribulose 1,5-bisphosphate carboxylase/oxygenase (rubisco) were isolated from two species of cyanobacteria (aphanothece halophytica and synechococcus acmm 323) as well as from the photosynthetic purple sulfur bacterium, chromatium vinosum. the subunit b is essential for the activity of all three enzymes. the heterologous hybridization of rubisco molecules from the three organisms was attempted and the reconstitution of the catalytically active hybr ... | 1985 | 3919715 |
| circular dichroism and redox properties of high redox potential ferredoxins. | the circular dichroism (cd) spectra of 13 examples of high-potential iron-sulfur proteins (hipips), a class of [4fe-4s] ferredoxins, have been determined. in contrast to the proposal of carter [carter, c. w., jr. (1977) j. biol. chem. 252, 7802-7811], no strict correlation between visible cd features and utilization of the [4fe-4s]2+/[4fe-4s]3+ oxidation levels was found. although most hipips have these features, the model requires their presence in all species. there is also no simple relations ... | 1985 | 3925987 |
| polyamines in photosynthetic eubacteria and extreme-halophilic archaebacteria. | qualitative and quantitative determinations of polyamines have been done in 4 photosynthetic eubacteria and 6 extreme-halophilic archaebacteria. for comparison, 5 moderate-halophilic eubacteria were also analyzed to determine their polyamine contents. not only putrescine and spermidine but also homospermidine were found in the photosynthetic eubacteria, especially in the n2-fixing species, rhodospirillum and chromatium. norspermidine, norspermine, and spermine were not detected in the phototroph ... | 1985 | 3928615 |
| isolation, characterization, and comparison of a ubiquitous pigment-protein complex consisting of a reaction center and light-harvesting bacteriochlorophyll proteins present in purple photosynthetic bacteria. | protein complexes (photochemical reaction complex; pr complex) bound to both light-harvesting bacteriochlorophyll-1 (lh-bchl-1) and reaction center bchl (rc-bchl) were purified from rhodospirillum rubrum (wild and carotenoid-less), rhodopseudomonas sphaeroides (wild), and chromatium vinosum (wild). another protein complex (lh-2 complex) bound to lh-bchl-2 was also purified from rps. sphaeroides. the bacteria were grown in the presence of a [14c]amino acid mixture. the purification procedure incl ... | 1985 | 3937841 |
| 13c-nmr evidence of bacteriochlorophyll a formation by the c5 pathway in chromatium. | the 13c-nmr spectra of bacteriochlorophyll a formed in the presence of l-[1-13c]glutamate and [2-13c]glycine in chromatium vinosum strain d were analyzed. the isotope in the glutamate was specifically incorporated into eight carbon atoms in the tetrapyrrole macrocycle derived from the c-5 of 5-aminolevulinic acid (ala), and the 13c in glycine was incorporated into the methyl carbon of the methoxycarbonyl group attached to the isocyclic ring of bacteriochlorophyll a. these labeling patterns provi ... | 1986 | 3963821 |
| effects of ph and exocyclic substitution on flavosemiquinone reactivity with redox proteins and inorganic oxidants. | the effect of ph on the reaction of free flavosemiquinone analogs generated by laser-flash photolysis with oxidized chromatium vinosum high-potential iron-sulfur protein, other iron-containing redox proteins, and nonbiological one-electron oxidants has been investigated. the results demonstrate that the second-order rate constant for the oxidation of lumiflavin flavosemiquinone increases dramatically with increasing ph for the redox proteins and some of the other oxidants. the ph-rate constant p ... | 1985 | 3985626 |
| active transport of nonpolar amino acids in chromatium vinosum. | the photosynthetic purple sulfur bacterium, chromatium vinosum, takes up the amino acids, l-phenylalanine and l-leucine, via two apparently different electrogenic, h+/amino acid symports. na+ serves as an allosteric modulator for leucine transport, lowering the km for leucine from 66 to 15 microm. c. vinosum cells also contain a system that transports both isoleucine and valine. the isoleucine/valine system has the attributes of a h+/amino acid symport at ph less than 7.5 but appears to function ... | 1985 | 3985631 |
| the amino acid sequence of a high-redox-potential ferredoxin from the purple phototrophic bacterium, rhodospirillum tenue strain 2761. | the 61-residue amino acid sequence of rhodospirillum tenue, strain 2761, high-redox-potential ferredoxin (hipip) is gtnaamrkafnyqdtakngkcsgcaqfvpgasptaaggckvipgdneiapggycdafivkk. it differs from that of r. tenue strain 3761 by 16 amino acid substitutions plus two single-residue deletions. this 26% sequence difference is similar to that observed among separate species of chromatiaceae such as chromatium vinosum, c. gracile, and thiocapsa roseopersicina, and is suprising because there are no disti ... | 1985 | 4004266 |
| amino acid sequence of high-redox-potential ferredoxin (hipip) isozymes from the extremely halophilic purple phototrophic bacterium, ectothiorhodospira halophila. | the amino acid sequences of high-redox-potential ferredoxin (hipip) isozymes from ectothiorhodospira halophila have been determined. these are: isozyme i, epraedghahdyvneaadpshgryqegqlcencafwgeavqdgwgrcthpdfdevlvkaegwcsvyapa s, and isozyme ii, glpdgvedlpkaeddhahdyvndaadtdharfqegqlcencqfwvdyvngwgycqhpdftdvlvrgegw csvyapa. isozyme ii is the major form of hipip produced by the bacterium (65-80%) and is the most acidic of the known hipips. the two isozymes are 72% identical to one another and requir ... | 1985 | 4037807 |
| isolation of l8 and l8s8 forms of ribulose bisphosphate carboxylase/oxygenase from chromatium vinosum. | the enzyme ribulose bisphosphate carboxylase/oxygenase has been purified from chromatium vinosum. when an extract is subjected to centrifugation at 35,000 x g in the presence of polyethylene glycol (peg)-6000 and the supernatant is treated with 50 mm mg2+ and the precipitate is then fractionated by vertical centrifugation into a reoriented sucrose gradient followed by chromatography on diethylaminoethyl (deae)-sephadex a50, the resultant enzyme contains large (l) and small (s) subunits. alternat ... | 1985 | 4037978 |
| kinetics of reduction of high redox potential ferredoxins by the semiquinones of clostridium pasteurianum flavodoxin and exogenous flavin mononucleotide. electrostatic and redox potential effects. | we have measured the ionic strength dependence of the rate constants for the electron-transfer reactions of flavin mononucleotide (fmn) and flavodoxin semiquinones with 10 high redox potential ferredoxins (hipip's). the rate constants were extrapolated to infinite ionic strength by using a theoretical model of electrostatic interactions developed in our laboratory. in all cases, the sign of the electrostatic interaction was the same as the protein net charge, but the magnitudes were much smaller ... | 1985 | 4074719 |
| structure of the chromatium sulfur particle and its protein membrane. | sulfur particles extracted from chromatium vinosum strain d were found to be bounded by a unique proteinaceous membrane. ultrastructural examination of the membrane in epon sections and bovine serum albumin sections and examination of negatively stained, sulfur-free membrane ghosts revealed a monomolecular sheet composed of 2.5-nm globular components. the internal sulfur was found to bind large amounts of a variety of negative stains and to form myelin-like structures upon rupture of the surroun ... | 1971 | 4100832 |
| the fine structure of chromatium buderi. | | 1973 | 4121821 |
| [oxidation of sulfite in chromatiaceae (brief report)]. | | 1972 | 4145606 |
| spectrophotometric studies of the mechanism of photosynthesis. | | 1970 | 4146947 |
| the bacteriochlorophyll absorption band shifts linked with the energy state of photosynthetic bacteria membranes. | | 1973 | 4200406 |
| [composition of nonconjugated pteridines in phototrophic bacteria]. | | 1974 | 4208903 |
| orthophosphate requirement for the formation of phosphoenolpyruvate from pyruvate by enzyme preparations from photosynthetic bacteria. | the formation of phosphoenolpyruvate from pyruvate and adenosine 5'-triphosphate by enzymes from photosynthetic bacteria required inorganic phosphate, thus indicating that these organisms utilize pyruvate, orthophosphate dikinase rather than phosphoenolpyruvate synthase in photosynthesis. | 1974 | 4212219 |
| one-step isolation of microbial ribulose-1,5-diphosphate carboxylase. | | 1974 | 4215394 |
| correlation between the level of vitamin-b12-dependent methionine synthetase and intracellular concentration of vitamin b12 in some bacteria. | | 1974 | 4215653 |
| properties of adenosinetriphosphatase in chromatophores and in coupling factor from the photosynthetic bacteria chromatium strain d. | | 1974 | 4275963 |
| different pathways for fructose and glucose utilization in rhodopseudomonas capsulata and demonstration of 1-phosphofructokinase in phototrophic bacteria. | | 1974 | 4277436 |
| magnetic and optical properties of some bacterial haem proteins. | | 1965 | 4285204 |
| ferredoxin linked dpn reduction by the photosynthetic bacteria chromatium and chlorobium. | | 1965 | 4286333 |
| nicotinamide adenine dinucleotide photoreduction with chromatium and rhodospirillum rubrum chromatophores. | | 1965 | 4286495 |
| trace metal composition of photosynthetic bacteria. | | 1968 | 4295561 |
| light-induced electron transport in chromatium strain d. i. isolation and characterization of chromatium chromatophores. | | 1968 | 4296024 |
| light-induced electron transport in chromatium strain d. ii. light-induced absorbance changes in chromatium chromatophores. | | 1968 | 4296025 |
| electron paramagnetic resonance studies on photosynthetic bacteria. i. properties of photo-induced epr-signals of chromatium d. | | 1968 | 4296026 |
| ferredoxin dependent synthesis of alpha-ketoglutarate and pyruvate by extracts of the green photosynthetis bacterium chloropseudoonas ethylicum. | | 1968 | 4301392 |
| cytochromes: chemical and structural aspects. | | 1968 | 4304596 |
| spectrophotometric titration of ferredoxins and chromatium high potential iron protein with sodium dithionite. | | 1969 | 4306283 |
| studies on the chelate structure of the high-potential iron protein of chromatium. | | 1969 | 4307588 |
| reductive titrations of iron-sulfur proteins containing two to four iron atoms. | | 1969 | 4310833 |
| solubilization and properties of the hydrogenase of chromatium. | | 1970 | 4313527 |
| composition of the sulfur particle of chromatium vinosum strain d. | sulfur particles were isolated from the purple sulfur photosynthetic bacterium, chromatium vinosum strain d. the composition of these particles was determined to be 93% sulfur, 5% protein, and 0.6% lipid. gel electrophoresis indicated the presence of a single protein species with a molecular weight of 13,500 daltons. from these results, the sulfur particle is postulated to be bounded by a membrane consisting entirely of protein. | 1971 | 4323293 |
| a low potential photosystem in chromatium d. | | 1971 | 4323694 |
| isolation and properties of rubredoxin from the photosynthetic green sulfur bacteria. | | 1971 | 4327795 |
| ribulose-5-phosphate kinase from chromatium sp. strain d. | | 1971 | 4330127 |
| [effect of inactivating factors on the epr signal and reduction of the iminoxyl radical in purple bacteria chromatophores]. | | 1971 | 4332218 |
| primary processes in photosynthesis: in situ esr studies on the light induced oxidized and triplet state of reaction center bacteriochlorophyll. | | 1972 | 4333414 |
| the primary electron acceptor in photosynthesis. | | 1972 | 4333415 |
| properties of the covalently bound flavin of chromatium cytochrome c-552 and its conversion to 8-carboxy-riboflavin. | | 1972 | 4334973 |
| characterization of primary reactants in bacterial photosynthesis. i. comparison of the light-induced epr signal (g=2.0026) with that of a bacteriochlorophyll radical. | | 1972 | 4339582 |
| on the monohene character of cytochromes c'. | interpretations of data bearing on structures of cytochromes cc'-a class of variant c-type heme proteins from bacteria-in support of a diheme-bearing single chain as a basic structural unit, appear to be invalid in the light of recent studies. these reveal that nearly all members of this class exist as dimers that can be dissociated into, if they do not already exist as, monoheme-bearing monomers. the particular case of the chromatium protein, held to be the source of a peptic-"core" peptide con ... | 1972 | 4343972 |
| [functional morphology of the bacterial cell]. | | 1972 | 4345136 |
| coproporphyrinogenase activities in extracts of rhodopseudomonas spheroides and chromatium strain d. | 1. the anaerobic coproporphyrinogenase activity in an extract of rhodopseudomonas spheroides is inhibited by 1,10-phenanthroline, alphaalpha'-bipyridyl, flavins, 2,4-dinitrophenol and 1,4-naphthaquinone. these compounds have no effect on the aerobic coproporphyrinogenase activity. 2. on removal of small-molecular-weight material from a crude extract, the anaerobic system becomes very unstable; it can be stabilized by adding succinate. now nicotinamide nucleotides, in addition to mg(2+), atp and ... | 1972 | 4345352 |
| anomalous ligand binding by a class of high spin c-type cytochromes. | | 1973 | 4346352 |
| water and cytochrome oxidation-reduction reactions. | | 1973 | 4349915 |
| structure of the flavin site of chromatium flavocytochrome c -552 . | | 1973 | 4351136 |
| iupac-iub commission on biochemical nomenclature (cbn). nomenclature of iron-sulfur proteins. 1973 recommendations. | | 1973 | 4351529 |
| the purification and some properties of the molybdenum-iron protein of chromatium nitrogenase. | | 1973 | 4352495 |
| electron spin resonance characterization of chromatium d hemes, non-heme irons and the components involved in primary photochemistry. | | 1973 | 4355789 |
| "super-reduction" of chromatium high-potential iron-sulphur protein in the presence of dimethyl sulphoxide. | | 1973 | 4356972 |
| measurement of the oxidation reduction potential of the epr detectable active centre of the molybdenum iron protein of chromatium nitrogenase. | | 1973 | 4357421 |
| the amino acid sequence of cytochrome c' from alcaligenes sp. n.c.i.b. 11015. | the amino acid sequence of the cytochrome c' from alcaligenes sp. n.c.i.b. 11015 (iwasaki's ;pseudomonas denitrificans') has been determined. this organism is the only non-photosynthetic bacterium in which the protein has been found. the protein consists of a single polypeptide chain of 127 residues, with a single haem covalently attached to two cysteines. unlike normal cytochromes c, the haem attachment site is very close to the c-terminus. the amino acid sequence around the haem attachment sit ... | 1973 | 4360249 |
| shifts of bacteriochlorophyll and carotenoid absorption bands linked to cytochrome c-555 photooxidation in chromatium. | | 1973 | 4360255 |
| identification of primary photosynthetic processes. | | 1973 | 4361883 |
| the detection and characterization by electron-paramagnetic-resonance spectroscopy of iron-sulphur proteins and other electron-transport components in chromatophores from the purple bacterium chromatium. | low-temperature e.p.r. (electron-paramagnetic-resonance) spectroscopy was used to detect electron-transport components in chromatium chromatophores with e.p.r. signals in the g=2.00 region. high-potential iron protein (e(m8.0)=+325mv, where e(m8.0) is the midpoint potential at ph8) and a second component (g=1.90, e(m8.0)=+285mv) are oxidized in illuminated chromatophores. two iron-sulphur proteins (g=1.94) with e(m8.0)=-290mv and e(m8.0)=-50mv are present. one (e(m8.0)=-50mv) is reduced on illum ... | 1974 | 4362737 |
| studies of resonance energy migration in a heterogeneous pigment complex. i. heterogeneity as a factor accelerating the localization of electron excitation in traps. | | 1972 | 4363521 |
| the function of cytochrome c. | | 1974 | 4363927 |
| magnetic studies on the changes in the iron environment in chromatium ferricytochrome c'. | | 1974 | 4364843 |
| photoconversions of bacteriochlorophylls and cytochromes in chromatium chromatophores and cells under reducing conditions. | | 1974 | 4365134 |
| synthetic analogs of the active sites of iron-sulfur proteins. 8. some electronic properties of (fe4s4(sr)4)3-, analogs of reduced bacterial ferredoxins. | | 1974 | 4365892 |
| identification of ubiquinone as the secondary electron acceptor in the photosynthetic apparatus of chromatium vinosum. | | 1974 | 4366890 |
| 8 alpha-substituted flavins of biological importance. | | 1974 | 4369457 |