Publications
| Title | Abstract | Year(sorted ascending) Filter | PMID Filter |
|---|
| [change in the ionic makeup of the cells in the early embryogenesis of the carp]. | 2006 | 562279 | |
| [presentation of an undetermined pathogenic agent responsible for the hemorrhagic septicemia syndrome in carp]. | 2006 | 5752918 | |
| [mechanisms of recognizing geometric figures and their elements--angles in fish (cyprinus carpio)]. | a study was made of the mechanisms of discrimination of geometrical figures and their angles by fish and of the influence of repeated presentation of stimuli on recognition time. the experiment was made by the conditioning method with the use of two variants of food-procuring technique: simultaneous and successive choice of stimuli. it was shown that discrimination of geomentrical figures is achieved at the fist stage by the mechanism of selection, and after long training, by the mechanism of ca ... | 2006 | 1210662 |
| [behavioral comparison of silver crucian-carp with different ploidies]. | 2006 | 4418098 | |
| [influence of oxygenation of the environment on the respiratory rhythm of a fresh water teleost: the carp]. | 2006 | 14037314 | |
| [thrombin and thrombokinase in the blood in carp]. | 2006 | 13766537 | |
| [histotopochemical demonstration of carbonic anhydrase in pseudobranchia of carp by okamoto's zinc reaction]. | 2006 | 13315757 | |
| [parasitic fauna of fishes in the "chilu-chor chashma" spring (tadzhik ssr) with a constant and high water temperature]. | the spring chilu-chor chashma (forty four springs) is situated in the south of tadzhikistan. in this water body water temperature is constant in any season of the year (18 to 20 c). ichthyofauna is represented by three species: varicorhinus heratensis steindachneri, alburnoides bipunctatus eichwaldi and cyprinus carpio. as a result of parasitological studies 20 species of parasites were recorded from 129 fishes. the parasite fauna of the fishes was investigated twice-in summer and in autumn. it ... | 2007 | 130595 |
| bioactivity of phytochemicals in some lesser-known plants and their effects and potential applications in livestock and aquaculture production systems. | livestock and aquaculture production is under political and social pressure, especially in the european union (eu), to decrease pollution and environmental damage arising due to animal agriculture. the eu has banned the use of antibiotics and other chemicals, which have been shown to be effective in promoting growth and reducing environment pollutants because of the risk caused to humans by chemical residues in food and by antibiotic resistance being passed on to human pathogens. as a result of ... | 2007 | 22444893 |
| biochemical and immunochemical characterization of the antigen-antibody reaction on a non-toxic biomimetic interface immobilized red blood cells of crucian carp and gold nanoparticles. | a special protein assay system based on a highly hydrophilic, non-toxic and conductive biominetic interface has been demonstrated. to fabricate such assay system, red blood cells of crucian carp (rbc) was initially grown on a glassy carbon electrode surface (gce) deposited nano-sized gold particles (gps), a second gold nanoparticle layer (ng) was then absorbed on the rbc surface, and finally mammary cancer 15-3 antibody (anti-ca15-3) was attached on the functional rbc surface. a competitive immu ... | 2007 | 16787745 |
| purification and properties of pituitary gonadotropic hormone from indian teleosts: freshwater murrel (channa punctatus) and carp (catla catla). | gonadotropic hormone (gth) from the pituitaries of two widely different indian teleosts, a freshwater murrel and a carp, was purified by solvent fractionation, sephadex g-100 gel filtration, affinity chromatography on concanavalin a-sepharose (con a-sepharose), and immunoaffinity chromatography. elution profile from gel filtration showed three peaks in both cases, peak i and ii were clearly separated in murrel but not in carp. peak ii demonstrated strong gth activity in both murrel and carp but ... | 2007 | 2920895 |
| histopathological changes in the livers and kidneys of fish in sariyar reservoir, turkey. | in this study, a total of 180 fish specimens (wels: silurus glanis-60; common carp: cyprinus carpio-60; bleak: alburnus escherichii-60) of ages between one and two were caught at three different stations in sariyar reservoir. the histological changes in the livers and kidneys of three different species of fish were detected microscopically and evaluated with quantitative analyses. also, organochlorine pesticide residues (ocp) have also been determined in the water and sediment samples and in the ... | 2007 | 21783764 |
| managing the koi herpesvirus disease outbreak in indonesia and the lessons learned. | in 2002, the suspected koi herpesvirus (khv) outbreak in indonesia was investigated by an international emergency disease control task force organized by naca immediately following a request for assistance by the government of indonesia. the task force gained immediate support from aciar, aahri, fao, centex-thailand, intervet, stirling university, and the university of california. the task force findings revealed the involvement of an infectious agent, an analogy with khv outbreaks, its introduc ... | 2007 | 18306515 |
| bioaccumulation of heavy metals in fishes from taihu lake, china. | the cr, zn, cu, cd, pb contents were determined in cyprinus carpio linnaeus, carassius auratus linnaeus, hypophthalmichthys molitrix and aristichthys nobilis, which were caught from meiliang bay, taihu lake, a large, shallow and eutrophic lake of china. the results showed that: (1) the cr, cu, pb, cd contents in the edible parts of the four fish species were much lower than chinese food health criterion (1994), but the zn contents were higher than the criterion; (2) cd contents were the highest ... | 2007 | 18277656 |
| chronic fluoxetine treatment induces brain region-specific upregulation of genes associated with bdnf-induced long-term potentiation. | several lines of evidence implicate bdnf in the pathogenesis of stress-induced depression and the delayed efficacy of antidepressant drugs. antidepressant-induced upregulation of bdnf signaling is thought to promote adaptive neuronal plasticity through effects on gene expression, but the effector genes downstream of bdnf has not been identified. local infusion of bdnf into the dentate gyrus induces a long-term potentiation (bdnf-ltp) of synaptic transmission that requires upregulation of the imm ... | 2007 | 18301726 |
| effects of lead nitrate (pbno3) on the glucose and cortisol hormone levels in common carp, cyprinus carpio. | the objective of this study was to evaluate the possible effects of pbno3 exposure on variations of glucose and cortisol levels in cyprinus carpio. fish were subjected to two sub-lethal concentrations of pbno3 for 14 days. blood samples were isolated from the fish following the exposure, to measure the levels of cortisol and glucose compared to the control group. we found significant increases (p<0.05) in the levels of blood cortisol in two groups of fish after 14 days of exposure to two concent ... | 2007 | 19070136 |
| the effects of salt and storage temperature on microbiological changes in hot-smoked mirror carp (cyprinus carpio l.). | in this study, microbiological changes during processing and preservation of smoked mirror carp (cyprinus carpio l.) fillets were examined. in the processing phase the brining in two different salt concentration and smoke were used. the conservation is realized in two different ambient temperatures. starting from raw material, a(w) and ph levels as well as mesophilic, psychrophilic, staphylococcus-micrococcus, coliform, the yeast and mould counts were determined at every stage. in conclusion, th ... | 2007 | 19090218 |
| assimilation efficiencies of cd and zn in the common carp (cyprinus carpio): effects of metal concentration, temperature and prey type. | the impact of several factors on the assimilation efficiency (ae) of cd and zn from food in the common carp (cyprinus carpio) was studied. tested prey species were midge larvae (chironomus riparius), zebra mussels (dreissena polymorpha) and oligochaetes (tubifex tubifex). the cd load of the larvae did not affect the cd ae in the carp. the zn ae however, was negatively related to the zn load of the prey. food quantity and starvation of the carp did not significantly affect the cd ae. for zn, a si ... | 2007 | 16764974 |
| non-specific immune parameters of brood indian major carp labeo rohita and their seasonal variations. | different non-specific immune parameters and their seasonal changes in brood indian major carp labeo rohita reared in two major freshwater aquaculture regions of india viz. west bengal and orissa were investigated. it was undertaken for 2 consecutive years and included three main seasons of a year such as summer (march-may), rainy (july-september) and winter (november-january). total serum protein, albumin and globulin levels were not significantly different throughout the year (p>0.01). serum l ... | 2007 | 16679030 |
| cloning and expression of an outer membrane protein ompts of aeromonas hydrophila and study of immunogenicity in fish. | the outer membrane proteins of the warm water fish pathogen, aeromonas hydrophila have a role in the virulence of the organism and are potential candidates for vaccine development. in this study, the gene encoding an outer membrane protein designated ompts was amplified by pcr excluding the region coding for signal peptide, cloned in pqe 30-ua vector and expressed using induction with isopropyl thiogalactoside (iptg). the size of the expressed protein was 37 kda as estimated by migration in 10% ... | 2007 | 16959494 |
| crucian carp (carassius carassius) vtg monoclonal antibody: development and application. | the vitellogenin (vtg) in fish has been used as an important biomarker for monitoring endocrine disrupting compounds (edcs). this paper reports the development of a new monoclonal antibody (mcab) against the vtg of crucian carp (carassius carassius). the mcab has a molecular weight of 149.4 kda (heavy chain: 53.1 kda; light chain: 21.6 kda), and double diffusion indicated that it belongs to the igg1 subclass. the titer is 10(5)-10(6) and the affinity constant (k(aff)) is 7.0 x 10(8)l/mol, showin ... | 2007 | 16469380 |
| genome sequences of three koi herpesvirus isolates representing the expanding distribution of an emerging disease threatening koi and common carp worldwide. | since the mid-1990s, lethal infections of koi herpesvirus (khv) have been spreading, threatening the worldwide production of common carp and koi (both cyprinus carpio). the complete genome sequences of three khv strains from japan, the united states, and israel revealed a 295-kbp genome containing a 22-kbp terminal direct repeat. the finding that 15 khv genes have clear homologs in the distantly related channel catfish virus (ictalurid herpesvirus 1) confirms the proposed place of khv in the fam ... | 2007 | 17329333 |
| modulation of carp (cyprinus carpio) neutrophil functions during an infection with the haemoparasite trypanoplasma borreli. | trypanoplasma borreli is an extracellular blood parasite of common carp (cyprinus carpio) transmitted by fish-biting leeches. the infestation with this parasite in juvenile carp may range between 75% and 100%, especially in fish recovering from the first hibernation period. t. borreli is perfectly adapted to its prolonged survival in a cyprinid host. elevated numbers of activated neutrophils in peripheral blood and tissues are reported during t. borreli infection, but in context of the disease, ... | 2007 | 17350287 |
| use of chemical communication in the management of freshwater aquatic species that are vectors of human diseases or are invasive. | chemical communication occurs when both originator (signaller) and one or more receiver(s) possess specializations for chemical exchange of information. chemical information can be used by a wide variety of species to locate food and mates, avoid predators and engage in social interactions. in this review, we focus on chemical signalling between mates or cues from nest sites or hosts by selected aquatic pest species and indicate how chemical information can be used to manage pests. the pests are ... | 2007 | 17367788 |
| the gene structure and expression of the non-specific cytotoxic cell receptor protein (nccrp-1) in atlantic cod (gadus morhua l.). | the non-specific cell receptor protein (nccrp-1) serves an important function in target cell recognition and activation of non-specific cytotoxic cells in teleosts. atlantic cod nccrp-1 was identified in a suppression-subtractive cdna library and nccrp-1 from atlantic salmon, rainbow trout, japanese medaka and fathead minnow was found deposited in the genbank as est sequences. the predicted amino acid sequences of these receptors contain the characteristic functional domains representing nccrp-1 ... | 2007 | 17368063 |
| recent development of anaerobic digestion processes for energy recovery from wastes. | anaerobic digestion leads to the overall gasification of organic wastewaters and wastes, and produces methane and carbon dioxide; this gasification contributes to reducing organic matter and recovering energy from organic carbons. here, we propose three new processes and demonstrate the effectiveness of each process. by using complete anaerobic organic matter removal process (carp), in which diluted wastewaters such as sewage and effluent from a methane fermentation digester were treated under a ... | 2007 | 17368391 |
| effects of polyherbal formulation 'immuplus' on immunity and disease resistance of indian major carp, labeo rohita at different stages of growth. | a series of experiments were performed to determine the impact of polyherbal immunomodulatory formulation 'immuplus' (aquaimmu) on growth, immunity and disease resistance of rohu (labeo rohita), one of the indian major carp at different stages of growth. rohu larvae were fed on plankton, immuplus-mixed compound feed, and plankton plus immuplus-mixed compound feed (immuplus added at three dose levels of 0.25, 0.50, and 0.75 g/kg feed) from 4th day of hatching to 14th day. immuplus-mixed diets enh ... | 2007 | 17373376 |
| serum antibody response of indian major carp, labeo rohita to three species of pathogenic bacteria; aeromonas hydrophila, edwardsiella tarda and pseudomonas fluorescens. | the immune response to mixed whole cell antigens of aeromonas hydrophila, edwardsiella tarda and pseudomonas fluorescens, the common gram negative bacterial pathogens associated with diseases of indian major carps were evaluated for their efficacy in triggering antibody responses in rohu, labeo rohita (ham.). the rohu yearlings were either immunized with antigens from single bacterial strain, a. hydrophila, e. tarda and p. fluorescens or a combination of all three. an antibody response was detec ... | 2007 | 17383016 |
| efficacy of some anticoccidial drugs for treating coccidial enteritis of the common carp caused by goussia carpelli (apicomplexa: eimeriidae). | in this study, nine anticoccidial drugs commonly used in poultry were tested for efficacy for the prevention and treatment of goussia carpelli (apicomplexa) infection in common carp (cyprinus carpio l.). to establish experimental infection with g. carpelli, paratenic host oligochaetes of the genera tubifex and limnodrilus were infected with oocysts, and laboratory-cultured parasite-free common carp fingerlings were infected by feeding to them oligochaetes containing sporozoites. the anticoccidia ... | 2007 | 17385557 |
| apolipoprotein a-i, an antimicrobial protein in oncorhynchus mykiss: evaluation of its expression in primary defence barriers and plasma levels in sick and healthy fish. | antimicrobial proteins and peptides play an important role in the primary defence barriers in vertebrates and invertebrates. in a previous study it was shown that high-density lipoprotein (hdl) and its major apolipoproteins, apoa-i and apoa-ii display antimicrobial activity in the carp (cyprinus carpio l.). the aim of this study was to evaluate if apoa-i conserves this defensive function in a salmonid fish like the rainbow trout, in spite of the low level of primary sequence conservation between ... | 2007 | 17391986 |
| structural and regulatory roles of muscle ankyrin repeat protein family in skeletal muscle. | the biological response of muscle to eccentric contractions (ecs) results in strengthening and protection from further injury. however, the cellular basis for this response remains unclear. previous studies identified the muscle ankyrin repeat protein (marp) family, consisting of cardiac ankyrin repeat protein (carp), ankyrin repeat domain 2/ankyrin repeat protein with pest and proline-rich region (ankrd2/arpp), and diabetes-associated ankyrin repeat protein (darp), as rapidly and specifically u ... | 2007 | 17392382 |
| [subtelomeric deletion 9qter: definition of the syndrome and parental origin in 2 patients]. | subtelomeric chromosome imbalances are increasingly known as a cause for mental retardation. new phenotypes associated with specific rearrangements are also being delineated, such as 9q microdeletion syndrome. here we define the major phenotypic features and the parental origin of 9q deletion. | 2007 | 17394858 |
| prokaryotic gene profiling assays to detect sediment toxicity: evaluating the ecotoxicological relevance of a cell-based assay. | despite their complexity, ecotoxicological measurements using higher level responses remain a major tool in the assessment of ecosystem integrity. nevertheless, the past decade saw an increasing number of cell based testing systems have found widespread application in ecotoxicology. one such test is bacterial bioreporters carrying a stress sensitive promoter fused to an easily detectable reporter gene. in the presence of a specific toxic stress,the expression cassette is switched on and the repo ... | 2007 | 17396675 |
| hematological and plasma biochemical responses of crucian carp (carassius auratus) to intraperitoneal injection of extracted microcystins with the possible mechanisms of anemia. | alterations in hematological indices such as decreases in blood cell counts (rbc), hematocrit (ht) and hemoglobin (hb) concentrations are key symptoms of anemia. however, few experiments were conducted to examine changes in hematological indices of fish exposed to microcystins that are believed to be fatal to circulatory systems of vertebrates. an acute toxicological experiment was designed to study hematological changes of crucian carp injected intraperitoneally (i.p.) with extracted microcysti ... | 2007 | 17400268 |
| carbonic anhydrases as drug targets--an overview. | at least 15 different alpha-carbonic anhydrase (ca, ec 4.2.1.1) isoforms were isolated in mammals, where these zinc enzymes play crucial physiological roles. some of these isozymes are cytosolic (ca i, ca ii, ca iii, ca vii, ca xiii), others are membrane-bound (ca iv, ca ix, ca xii, ca xiv and ca xv), ca va and ca vb are mitochondrial, and ca vi is secreted in saliva and milk. three acatalytic forms are also known, the ca related proteins (carp), carp viii, carp x and carp xi. representatives of ... | 2007 | 17504127 |
| transactivator of transcription-tagged cell cycle and apoptosis regulatory protein-1 peptides suppress the growth of human breast cancer cells in vitro and in vivo. | deregulated signaling by the epidermal growth factor receptor family of proteins is encountered in human malignancies including breast cancer. cell cycle and apoptosis-regulatory protein-1 (carp-1), a novel, perinuclear phosphoprotein, is a regulator of apoptosis signaling by epidermal growth factor receptors. carp-1 expression is diminished in human breast cancers, and correlates inversely with human breast cancer grades which could be attributed to increased methylation. the expression of carp ... | 2007 | 17513614 |
| morphological and genetic differences of trypanosoma in some chinese freshwater fishes: difficulties of species identification. | blood smears and purified trypanosome from freshwater fishes yellow catfish (pseudobagras fulvidraco) and common carp (cyprinus carpio) captured from niushan lake, hubei province were examined to determine whether all of their trypanosomes were trypanosoma pseudobagri, a species of supposed host specificity and widespread existence across china. trypanosomes occurred in 16/16 blood smears, and morphometric character analysis of trypanosomes from these smears showed that there were three morphosp ... | 2007 | 17558522 |
| comparison of the uptake of polycyclic aromatic hydrocarbons and organochlorine pesticides by semipermeable membrane devices and caged fish (carassius carassius) in taihu lake, china. | uptake of polycyclic aromatic hydrocarbons (pahs) and organochlorine pesticides (ocps) by triolein-containing semipermeable membrane devices (spmds) and by crucian carp (carassius carassius) was studied in taihu lake, a shallow, freshwater lake in china. crucian carp and spmds were deployed side by side for 32 d. the first-order uptake rate constants of individual pahs and ocps for the two matrices were calculated and compared to relate the amounts of chemicals accumulated by the matrices to dis ... | 2007 | 17571693 |
| [the effects of parasites on the growth of the crucian carp (carassius carassius l., 1758) inhabiting the kovada lake]. | the aim of this study carried out between march 2003-february 2004 was to determine the effects of parasites on the growth of the crucian carp (carassius carassius l., 1758) inhabiting the kovada lake. a total of 102 specimens were caught monthly and investigated parasitologically. the age distribution of these fish were found to be between 3-7 years and 54 (52.9%) were infected by the various parasites. investigations of fish that were caught during the same month of the same sex and of the sam ... | 2007 | 17594663 |
| actin filament organization of foot processes in vertebrate glomerular podocytes. | we investigated the actin filament organization and immunolocalization of actin-binding proteins (alpha-actinin and cortactin) in the podocyte foot processes of eight vertebrate species (lamprey, carp, newt, frog, gecko, turtle, quail, and rat). three types of actin cytoskeleton were found in these foot processes. (1) a cortical actin network with cortactin filling the space between the plasma membrane and the other actin cytoskeletons described below was found in all of the species examined her ... | 2007 | 17605050 |
| on the role of nr3a in human nmda receptors. | in the present paper we describe our on-going project investigating the functional roles of the n-methyl-d-aspartate (nmda) receptor subunit nr3a. we find that nr3a mrna is abundant both in embryonic and adult human brain, in contrast to the almost non-existing expression in adult rodent brain. human nr3a (hnr3a) protein expression is particularly abundant in the cerebral cortex, as shown by western blot using nr3a-specific antibodies. distribution of hnr3a in adult human brain shows a similar p ... | 2007 | 17617428 |
| prevalence of fishborne zoonotic parasites in important cultured fish species in the mekong delta, vietnam. | a seasonal investigation on the occurrence of fishborne zoonotic trematodes (fzt) in economically important mono-cultured hybrid catfish and giant gouramy was conducted in the mekong delta of vietnam. fish from carp poly-culture and intensive small-scale integrated vegetable-aquaculture-animal husbandry farming (vac) systems were also examined. no fzt metacercariae were found in any mono-cultured hybrid catfish. fzt metacercariae were common, however, in fish from the other three systems: all me ... | 2007 | 17618460 |
| biochemical and ultrastructural changes of the liver and kidney of the phytoplanktivorous silver carp feeding naturally on toxic microcystis blooms in taihu lake, china. | many experimental studies have documented the impact of microcystins (mc) on fish based on either intraperitoneal injection, or oral gavaging via the diet, but few experiments were conducted by mc exposure through natural food uptake in lakes. in this study, the phytoplanktivorous silver carp were stocked in a large pen set in meiliang bay of taihu lake where toxic microcystis blooms occurred in the warm seasons. fish samples were collected monthly and mc concentrations in liver and kidney of th ... | 2007 | 17412382 |
| persistent chlorinated pesticides in fish species from qiantang river in east china. | thirteen organochlorine pesticides (ocps) in 18 fish species from qiantang river were firstly determined by gc-ecd. to elucidate the sources and the environment fate of these pollutants, water and sediment samples were also analyzed for ocps contents. total concentrations of ocps in fish muscles ranged from 7.43 to 143.79 ng g(-1) wet weight (ww) with highest concentration recorded in sole fish (cynoglossus abbreviatus), a benthic carnivore. the results indicated that carnivore fish have higher ... | 2007 | 17420036 |
| interspecific and intraspecific interactions in the monogenean communities of fish: a question of study scale? | monogenean communities of fish have generally been considered non-interactive as negative interspecific interactions have rarely been reported. most of the earlier studies on monogenean communities, however, have been conducted not only in systems with relatively low parasite abundances but, more importantly, at study scales where microhabitat-level interactions between the parasites are easily overlooked. we examined the communities of 3 abundant dactylogyrus (monogenea) species on the gills of ... | 2007 | 17428351 |
| effects of long-term alachlor exposure on hepatic antioxidant defense and detoxifying enzyme activities in crucian carp (carassius auratus). | alachlor has been widely used in agriculture all over the world. it is suggested that it may be a carcinogen and also an environmental estrogen. in this paper, the physiological and biochemical perturbations of crucian carp (carassius auratus) exposed to alachlor at different concentrations over 60 days were investigated. the gonadosomatic index (gsi) and hepatosomatic index (hsi) were measured. the activity of hepatic antioxidant defense and detoxifying enzymes, superoxide dismutase (sod), cata ... | 2007 | 17433409 |
| mercury contamination in the vicinity of a derelict chlor-alkali plant part ii: contamination of the aquatic and terrestrial food chain and potential risks to the local population. | this study investigated the environmental impact and level of risk associated with mercury (hg) contamination near a derelict chlor-alkali plant in pavlodar, northern kazakhstan. several species of fish were sampled from the highly polluted lake balkyldak and the nearby river irtysh, to assess the extent of hg bioaccumulation in the aquatic food chain and potential human health risks. a small number of bovine tissue samples, water samples, soil and plant samples from a nearby village were also i ... | 2007 | 17433415 |
| effect of dietary supplementation of probiotic and vitamin c on the immune response of indian major carp, labeo rohita (ham.). | the immunostimulatory effect of probiotics and vitamin c has been established in many systems including fish. an investigation was carried out to study the effect of dietary supplementation of a probiotic bacterium "bacillus subtilis", vitamin c in the form of ascorbyl polyphosphate and their combination on the immune response of indian major carp, rohu, (labeo rohita ham.) fingerlings fed for a period of 60 days. the total serum protein and globulin content was significantly higher (p<0.05) in ... | 2007 | 17434319 |
| characterization of complete genome sequence of the spring viremia of carp virus isolated from common carp (cyprinus carpio) in china. | the complete genome of spring viraemia of carp virus (svcv) strain a-1 isolated from cultured common carp (cyprinus carpio) in china was sequenced and characterized. reverse transcription-polymerase chain reaction (rt-pcr) derived clones were constructed and the dna was sequenced. it showed that the entire genome of svcv a-1 consists of 11,100 nucleotide base pairs, the predicted size of the viral rna of rhabdoviruses. however, the additional insertions in bp 4633-4676 and bp 4684-4724 of svcv a ... | 2007 | 17447109 |
| phylogenetic analysis of intestinal bacteria and their adhesive capability in relation to the intestinal mucus of carp. | the aims of the present study are to characterize the intestinal microbial community displaying a high-adhesive capability in fish, and to evaluate the relationship between mucosal adhesion of intestinal bacteria and fish health and disease. | 2007 | 17448166 |
| complementary dna cloning and organ expression of cytochrome p450 1c2 in carp (cyprinus carpio). | cytochrome p450 (cyp) genes, which make up a large gene superfamily, are known to play an important role in drug metabolism. the cyp1 family, one of the gene families of the cyp superfamily, has three subfamilies of genes whose sequences have been deposited in the genbank/embl thus far: cyp1a, cyp1b, and cyp1c. mammals as well as fish confront numerous foreign chemicals in the environment that may accumulate to toxic levels unless they are metabolized and eliminated by processes largely mediated ... | 2007 | 17450118 |
| comparison of serum vitellogenin, steroid hormone, gonad histopathology and bioaccumulation in common carp (cyprinus carpio) of two rivers and a lake in japan: potential for endocrine disruption. | to investigate endocrine disruption and chemical contaminant levels in the aquatic environment, serum vitellogenin (vtg) induction, steroid hormone synthesis, gonad histopathology and nonylphenol (np) bioaccumulation were measured in common carp (cyprinus carpio) in three sites (two rivers and one lake, in which high, medium, and low np concentrations were detected in a previous study) in japan from november 2001 to february 2002. the average gonadosomatic indexes (gsis) for males were 3.9% in t ... | 2007 | 17450120 |
| population dynamics and maturation cycle of camallanus cotti (nematoda: camallanidae) in the chinese hooksnout carp opsariichthys bidens (osteichthyes: cyprinidae) from a reservoir in china. | the seasonal population dynamics and maturation cycle of the nematode camallanus cotti in the posterior intestine of chinese hooksnout carp opsariichthys bidens have been studied in the danjiangkou reservoir of the hubei province in central china from september 2004 to november 2005. the overall prevalence, mean abundance and intensity of c. cotti among fish sampled (n=700 fish) were 47%, 2.29+/-12.38 (+/-s.d.) and 1-307 (average 4.89+/-17.74), respectively. the overall sexual ratio of female to ... | 2007 | 17459589 |
| perexilibacter aurantiacus gen. nov., sp. nov., a novel member of the family 'flammeovirgaceae' isolated from sediment. | a strictly aerobic, gram-negative, gliding, dull-orange-pigmented, rod-shaped bacterium, designated strain shu-f-uv2-2(t), was isolated from sediment (carp island, republic of palau) and was the focus of a polyphasic taxonomic study. phylogenetic analyses based on the 16s rrna gene sequence revealed that the novel isolate was affiliated to the family 'flammeovirgaceae' of the phylum bacteroidetes and that it showed highest sequence similarity (85.5 %) to flammeovirga yaeyamensis nbrc 100898(t). ... | 2007 | 17473242 |
| carbonic anhydrases as targets for medicinal chemistry. | carbonic anhydrases (cas, ec 4.2.1.1) are zinc enzymes acting as efficient catalysts for the reversible hydration of carbon dioxide to bicarbonate. 16 different alpha-ca isoforms were isolated in mammals, where they play crucial physiological roles. some of them are cytosolic (ca i, ca ii, ca iii, ca vii, ca xiii), others are membrane-bound (ca iv, ca ix, ca xii, ca xiv and ca xv), ca va and ca vb are mitochondrial, and ca vi is secreted in saliva and milk. three acatalytic forms are also known, ... | 2007 | 17475500 |
| a recombinant hypoallergenic parvalbumin mutant for immunotherapy of ige-mediated fish allergy. | ige-mediated allergy to fish is a frequent cause of severe anaphylactic reactions. parvalbumin, a small calcium-binding protein, is the major fish allergen. we have recently isolated a cdna coding for carp parvalbumin, cyp c 1, and expressed in escherichia coli a recombinant cyp c 1 molecule, which contained most ige epitopes of saltwater and freshwater fish. in this study, we introduced mutations into the calcium-binding domains of carp parvalbumin by site-directed mutagenesis and produced in e ... | 2007 | 17475857 |
| protection against atypical aeromonas salmonicida infection in carp (cyprinus carpio l.) by oral administration of humus extract. | humic substances are formed during the decomposition of organic matter in humus, and are found in many natural environments in which organic materials and microorganisms have been present. in the present study, oral administration of humus extract to common carp (cyprinus carpio l.) induced effective protection against experimental atypical aeromonas salmonicida infection. mortality of fish and development of skin lesions such as hemorrhages and ulcers were significantly suppressed in carp treat ... | 2007 | 17485929 |
| susceptibility of cyprinid cultured cells to cyprinid herpesvirus 3. | cyprinid herpesvirus 3 is a highly contagious and lethal virus that affects ornamental koi and common carp worldwide. however, it is not yet known whether other cyprinids are infected and/or harbor the virus. here, we report that cultured cells derived from common carp, koi, silver carp and goldfish allow cyhv-3 propagation, while cyprinid cells derived from fathead minnow and non-cyprinid cells derived from the channel catfish ovary are resistant to cyhv-3 infection. interestingly, the epitheli ... | 2007 | 17497237 |
| dominant pathogenic species of mesophilic aeromonads isolated from diseased and healthy fish cultured in poland. | aeromonas isolates were collected from cultured fish, characterized phenotypically and identified to species using 16s rdna. the pathogenicity of all isolates was assayed on the basis of haemolytic and proteolytic activity and challenge tests were performed for isolates from healthy fish. a total of 131 aeromonas isolates were obtained and identified as follows: a. hydrophila (13), a. bestiarum (23), a. salmonicida (motile biogroup) (19), a. caviae (2), a. sobria (18), a. veronii bt. sobria (42) ... | 2007 | 17501739 |
| ichthyophthirius multifiliis infection induces massive up-regulation of serum amyloid a in carp (cyprinus carpio). | a real time quantitative pcr (rq-pcr) assay was developed for measurement of differential expression of the genes encoding the acute phase reactant serum amyloid a (saa), transferrin (tf) and a c-type lectin molecule (cl) in skin, blood and liver from cyprinus carpio following infection with the ectoparasite ichthyophthirius multifiliis. serum amyloid a and cl were constitutively expressed in all organs evaluated while tf transcripts were only detected in the liver. a dramatic up-regulation (160 ... | 2007 | 17095098 |
| improvement and observation of immunoelectron microscopic method for the localization of frog rana grylio virus (rgv) in infected fish cells. | in this paper, to understand the roles of amorphous structures which were observed within the viromatrix of rana grylio virus (rgv), an improved immunoelectron microscopy (iem) method was developed to detect the localization of rgv in carp epithelipma papulosum cyprinid (epc) cells. infected epc cells were fixed with 4% paraformaldehyde-0.25% glutaraldehyde mixture, dehydrated completely, and embedded in lr white resin. this method allowed good ultrastructural preservation and specific labeling ... | 2007 | 17095234 |
| complement expression in common carp (cyprinus carpio l.) during infection with ichthyophthirius multifiliis. | a real-time pcr assay for determination of the complement response to infection with the ectoparasite ichthyophthirius multifiliis in carp is presented. specific primers were designed for selected genes representing the three pathways of the carp complement system. the investigated complement molecules were c1r/s, c3, c4, c5, factor i, factor b/c2-a (bf/c2-a), mannose-binding lectin (mbl) and mbl-associated serine protease (masp). the expression of the selected genes was analyzed on rna extracts ... | 2007 | 17107712 |
| protective efficacy of recombinant ompts protein of aeromonas hydrophila in indian major carp. | 2007 | 17113689 | |
| carps are ubiquitin ligases that promote mdm2-independent p53 and phospho-p53ser20 degradation. | caspase 8/10-associated ring proteins (carps) are a recently described family of protein ubiquitin ligases that interact with and negatively regulate death receptor-mediated apoptosis. because carps are overexpressed in cancer and their silencing reduces cell viability and sensitizes tumor cells to chemotherapeutic agents, we investigated their relationship to p53 tumor suppressor signaling. p53 is a major determinant of chemosensitivity, and its levels are increased following dna damage through ... | 2007 | 17121812 |
| real-time gene expression analysis in carp (cyprinus carpio l.) skin: inflammatory responses caused by the ectoparasite ichthyophthirius multifiliis. | real time quantitative pcr (rq-pcr) assays were developed for the measurement of differential real-time expression of immune-related genes in skin and whole blood from cyprinus carpio during an infection with the ectoparasite ichthyophthirius multifiliis. the target genes included the chemokines cxca and cxcb, the chemokine receptors cxcr1 and cxcr2, the pro-inflammatory cytokines interleukin 1 beta (il-1beta) and tumour necrosis factor alpha (tnf-alpha) and the enzymes inducible nitric oxide sy ... | 2007 | 17046281 |
| comparison of multiple genes of spring viremia of carp viruses isolated in the united states. | five spring viremia of carp viruses (svcv), rhabdovirus carpio, were isolated in the united states (us) between 2002 and 2004. single tube reverse transcription-polymerase chain reaction (rt-pcr) was used to generate overlapping cdna fragments from the us isolates of svcv. multiple pairs of specific primers were designed to amplify a portion of the phosphoprotein gene, the matrix gene, and the glycoprotein gene of svcv genogroup id (corresponding to nucleotides 2174-4942 of genbank accession nc_ ... | 2007 | 17048110 |
| cutaneous immune responses in the common carp detected using transcript analysis. | in order to detect new immune-related genes in common carp (cyprinus carpio l.) challenged by an ectoparasitic infection, two cdna libraries were constructed from carp skin sampled at 3 and 72h after infection with ichthyophthirius multifiliis. in a total of 3500 expressed sequence tags (ests) we identified 82 orthologues of genes of immune relevance previously described in other organisms. of these, 61 have never been described before in c. carpio, thus shedding light on some key components of ... | 2007 | 17049603 |
| heavy metal and trace elements in various fish samples from sir dam lake, kahramanmaraş, turkey. | achanthobrama marmid (thorn-bream) (n:24), chondrostoma regium (nose-carp) (n:33) and silurus glanis (wels) (n:21), and cyprinus carpio (carp) (n:30) were collected from sir dam lake in kahramanmaraş province. the iron (fe), manganese (mn), cobalt (co), nickel (ni), and lead (pb) levels were determined in the total of 108 fish samples by atomic absorption spectrophotometer. the concentrations of heavy metals were expressed as mg kg(-1) wet weight of tissue. the mean fe and mn levels of muscle an ... | 2007 | 17057953 |
| redescription of trypanosoma siniperca chang 1964 from freshwater fish of china based on morphological and molecular data. | during the parasite fauna investigation within 2005, the freshwater fish trypanosome trypanosoma siniperca chang 1964 was isolated from the blood of mandarin carp (siniperca chuatsi) from niushan lake, hubei province, central china. blood trypomastigotes were observed only, and the density of infection was low. light microscopy examinations of this material made it possible to study in detail the morphology of this parasite and redescribe it according to current standards. t. siniperca is charac ... | 2007 | 17063366 |
| congener distribution of polybrominated diphenyl ethers in feral carp (cyprinus carpio) from the llobregat river, spain. | feral carp were collected at two spanish rivers, anoia and cardener, showing pbde levels from 29 to 638 ng/g lipid weight (lw) and from 54 to 744 ng/g lw, respectively. sediments were also collected, showing pbde contamination between 2 and 10 ng/g dry weight (dw). differences in pbde profiles between sediments and fish were noticed. contribution of bde-47 in sediment was up to 11%, whereas it contributed 37-90% of pbdes in fish. similar results were observed for bde-154, which was only detected ... | 2007 | 17010488 |
| effects of streptozotocin-induced diabetes and physical training on gene expression of titin-based stretch-sensing complexes in mouse striated muscle. | in striated muscle, a sarcomeric noncontractile protein, titin, is proposed to form the backbone of the stress- and strain-sensing structures. we investigated the effects of diabetes, physical training, and their combination on the gene expression of proteins of putative titin stretch-sensing complexes in skeletal and cardiac muscle. mice were divided into control (c), training (t), streptozotocin-induced diabetic (d), and diabetic training (dt) groups. training groups performed for 1, 3, or 5 w ... | 2007 | 17003243 |
| acute effects of an anatoxin-a producing cyanobacterium on juvenile fish-cyprinus carpio l. | the worldwide increase of eutrophication in fresh water bodies has caused cyanobacterial blooms to be more frequent. anatoxin-a is a potent neurotoxin known to be produced by several genera of cyanobacteria including anabaena. in this work, we exposed juvenile carps to freeze-dried cells of a toxic strain of the cyanobacterium anabaena sp. during a 4-day period. two different cell density--10(5) and 10(7) cell ml(-1)--were assayed. lethality and anatoxin-a concentration in the whole fish were de ... | 2007 | 17196237 |
| ultrastructural effects of pharmaceuticals (carbamazepine, clofibric acid, metoprolol, diclofenac) in rainbow trout (oncorhynchus mykiss) and common carp (cyprinus carpio). | in order to assess potential effects of human pharmaceuticals in aquatic wildlife, laboratory experiments were conducted with carbamazepine, clofibric acid, metoprolol, and diclofenac using fish as test organisms. for each substance, at least one environmentally relevant concentration was tested. in liver, kidney, and gills of trout and carp exposed to carbamazepine, clofibric acid, and metoprolol, ultrastructural effects were qualitatively described and semi-quantitatively assessed. the obtaine ... | 2007 | 17216161 |
| dose-response relationships and statistical performance of a battery of bacterial gene profiling assays. | because of increasing awareness and legislative demands, there is a demand for the development and use of biological assays for the assessment of the toxicity of chemicals, environmental samples. recently, a growing number of bacterial reporter assays have been developed and implemented. nevertheless, little data is published on the performance of these assays in terms of analytical parameters. we present results on a battery of 14 transgenic escherichia coli strains carrying different promoter: ... | 2007 | 17225096 |
| upregulated expression of cardiac ankyrin-repeated protein in renal podocytes is associated with proteinuria severity in lupus nephritis. | cardiac ankyrin-repeated protein (carp) was originally identified as a protein specifically expressed in cardiomyocytes, but has recently been found to be upregulated in some muscle diseases including muscular dystrophy and myopathy, suggesting that carp may be induced in some pathologic conditions. in this study, we immunohistochemically analyzed 69 renal biopsy samples from patients with glomerular diseases and 2 individuals with normal kidney. we found that carp was expressed in renal podocyt ... | 2007 | 17239933 |
| mixed infection with trypanoplasma borreli and trypanosoma carassii induces protection: involvement of cross-reactive antibodies. | mixed infections with trypanoplasma borreli and trypanosoma carassii in common carp (cyprinus carpio l.) are commonly found in nature. so far, in the laboratory, only mono-parasitic infections have been examined in more detail. we studied the influence of mixed rather than mono-parasitic infections on the protective immune response in this naturally occurring host-parasite combination. mixed infections were established in the laboratory by i.p. injection of fixed numbers of both parasite species ... | 2007 | 17257676 |
| phosphorus loadings associated with a park tourist attraction: limnological consequences of feeding the fish. | the linesville spillway of pymatuning state park is one of the most visited tourist attractions in pennsylvania, usa, averaging more than 450,000 visitors . year(-1). carp (cyprinus carpio linnaeus) and waterfowl congregate at the spillway where they are fed bread and other foods by park visitors. we hypothesized that the "breadthrowers" constitute a significant nutrient vector to the upper portion of pymatuning reservoir. in the summer of 2002, we estimated phosphorus loadings attributable to b ... | 2007 | 17265114 |
| identification of the endogenous ligands for chicken growth hormone-releasing hormone (ghrh) receptor: evidence for a separate gene encoding ghrh in submammalian vertebrates. | it is generally believed that hypothalamic ghrh activates ghrh receptor (ghrhr) to stimulate gh synthesis and release in the pituitary of mammals. however, the identity of the endogenous ligand of ghrhr is still unresolved in submammalian vertebrates including birds. in this study, we have successfully identified the chicken ghrh (cghrh) gene, which consists of seven exons including two exons (exons 4 and 5) coding for the predicted mature ghrh peptide of 47 amino acids. interestingly, the diffe ... | 2007 | 17272401 |
| effect of different cyanobacterial biomasses and their fractions with variable microcystin content on embryonal development of carp (cyprinus carpio l.). | while numerous studies focused on the effects of microcystins, the role of other components of complex cyanobacterial water blooms in toxicity is poorly understood. in this study we have evaluated effects of various fractions of cyanobacterial biomass with different composition and microcystin content on embryolarval development of carp (cyprinus carpio). the following samples (fractions) of four natural water blooms were prepared and tested: complex cyanobacterial biomass, crude aqueous extract ... | 2007 | 17280727 |
| persistence of cyprinid herpesvirus 3 in infected cultured carp cells. | cyprinid herpesvirus 3 (cyhv-3), previously designated carp interstitial nephritis and gill necrosis virus or koi herpesvirus, is the cause of a worldwide mortal disease of koi and carp. morphologically, the virus resembles herpesviruses, yet it bears a genome of 277 to 295 kbp, which is divergent from most of the genomic sequences available in genbank. the disease afflicts fish in the transient seasons, when the water temperature is 18 to 28 degrees c, conditions which permit virus propagation ... | 2007 | 17301126 |
| dietary microbial levan enhances cellular non-specific immunity and survival of common carp (cyprinus carpio) juveniles. | a preliminary study with a 75days feeding trial was conducted to study the immunomodulatory effect of microbial levan on cyprinus carpio juveniles. five purified isonitrogenous and isocaloric diets with graded levels of levan, namely (t(1)) 0.1% levan, (t(2)) 0.2% levan, (t(3)) 0.5% levan, (t(4)) 1.0% levan, and a control group without levan were fed to five groups of fishes in triplicate. the total erythrocyte count and haemoglobin content was significantly (p<0.05) enhanced in the t(3) group, ... | 2007 | 17158064 |
| toxicity of microcystins in the isolated hepatocytes of common carp (cyprinus carpio l.). | the toxicity of hepatotoxic microcystins produced mainly by microcystis aeruginosa in mammals and fishes was well studied in recent years. however, there were scarcely reports in toxic effects of microcystins on isolated hepatocytes of fishes, especially investigation of microcystin-induced apoptosis and/or necrosis in carp hepatocytes. in the present study, the isolated hepatocytes of common carp were exposed to various concentrations of microcystins (0.01, 0.1, 1, 10, 100, 1000 microg l(-1)) f ... | 2007 | 17137627 |
| przewalski's naked carp (gymnocypris przewalskii): an endangered species taking a metabolic holiday in lake qinghai, china. | the naked carp is an endangered cyprinid that migrates annually between freshwater rivers, where it spawns, and lake qinghai, where it feeds and grows. lake qinghai is a high-altitude lake (3,200 m) in western china that currently exhibits the following composition (in mmol l(-1): [na(+)] 200, [cl(-)] 173, [mg(2+)] 36, [ca(2+)] 0.23, [k(+)] 5.3, total co(2) 21, titration alkalinity 29; osmolality 375 mosm kg(-1); ph 9.3), but concentrations are increasing because of water diversion and climate c ... | 2007 | 17160880 |
| altered expression of fhl1, carp, tsc-22 and p311 provide insights into complex transcriptional regulation in pacing-induced atrial fibrillation. | atrial fibrillation (af) is the most common progressive disease in patients with cardiac arrhythmia. af is accompanied by complex atrial remodeling and changes in gene expression, but only a limited number of transcriptional regulators have been identified. using a low-density cdna array, we identified 31 genes involved in transcriptional regulation, signal transduction or structural components, which were either significantly upregulated or downregulated in porcine atria with fibrillation (indu ... | 2007 | 17174532 |
| alterations in the levels of ions in blood and liver of freshwater fish, cyprinus carpio var. communis exposed to dimethoate. | the fingerlings of cyprinus carpio var. communis were exposed to sublethal concentration of dimethoate for 7, 14 days to evaluate the impact of the pesticide dimethoate on different ions namely sodium, potassium, chloride, calcium, magnesium. the blood potassium, calcium, magnesium and liver chloride and magnesium levels were elevated under sublethal condition. the blood sodium, chloride and liver sodium, potassium, and calcium levels were found to be significantly decreased. | 2007 | 17180417 |
| contaminants-induced oxidative damage on the carp cyprinus carpio collected from the upper yellow river, china. | the yellow river, the second largest river in china, is the most important resource of water supply in north china. in the last 40 years, even in the upper yellow river, with the development of industry and agriculture, more and more contaminants have been discharged into this river and greatly polluted the water. although a routine chemical component analysis has been performed, little is known about the real toxic effects of the polluted water on organisms at environmental level. to explore wh ... | 2007 | 17180433 |
| presence and inducibility by beta-naphthoflavone of cyp1a1, cyp1b1 and phase ii enzymes in trematomus bernacchii, an antarctic fish. | this study investigated some aspects of xenobiotic metabolism in the nototheniidae trematomus bernacchii, a key sentinel species for monitoring antarctic ecosystems. after laboratory exposure to beta-naphthoflavone (betanf), basal levels and time-course induction of cyp1a, cyp1b and cyp3a were measured as enzymatic activities, immunoreactive protein content and mrna expression in liver, gills, intestine and heart. additional analyses in the liver included enzymatic activities of testosterone hyd ... | 2007 | 17643506 |
| genome-wide mapping of modifier chromosomal loci for human hypertrophic cardiomyopathy. | hypertrophic cardiomyopathy (hcm) is a disease of mutant sarcomeric proteins (except for phenocopy). cardiac hypertrophy is the clinical diagnostic hallmark of hcm and a major determinant of morbidity and mortality in various cardiovascular diseases. however, there is remarkable variability in expression of hypertrophy, even among hcm patients with identical causal mutations. we hypothesized modifier genes are partly responsible for the variation in hypertrophic expressivity. to map the modifier ... | 2007 | 17652099 |
| using semipermeable membrane devices, bioassays, and chemical analysis for evaluation of bioavailable polycyclic aromatic hydrocarbons in water. | meiliang bay is a sublake of taihu lake and has been polluted by domestic and industrial effluents. as part of a comprehensive risk assessment project in this region, semipermeable membrane devices (spmds) were applied to evaluate the levels and potential toxic potency of polycyclic aromatic hydrocarbons (pahs) in lakewater, in combination with chemical analysis and in vitro bioassay using h4iie rat hepatoma cells. in addition, induction of hepatic ethoxyresorufin-o-deethylase (erod) activity, i ... | 2007 | 17657463 |
| linking human nutrition and fisheries: incorporating micronutrient-dense, small indigenous fish species in carp polyculture production in bangladesh. | fish and fisheries are important for the livelihoods, food, and income of the rural population in bangladesh. increased rice production and changing agricultural patterns have resulted in a large decline in inland fisheries. implementation of carp pond polyculture has been very successful, whereas little focus has been given to the commonly consumed small indigenous fish species, some of which are rich in vitamin a and minerals, such as calcium, iron, and zinc, and are an integral part of the ru ... | 2007 | 17658074 |
| the effects of three organic chemicals on the upper thermal tolerances of four freshwater fishes. | the upper temperature tolerance limits of four freshwater fish species, silver perch bidyanus bidyanus, eastern rainbowfish melanotaenia duboulayi, western carp gudgeon hypseleotris klunzingeri, and rainbow trout oncorhynchus mykiss, were determined using the critical thermal maximum (ctmaximum) method. the ctmaximum tests were carried out with unexposed fish and fish exposed to sublethal concentrations of endosulfan, chlorpyrifos, and phenol to determine whether or not the ctmaximum was affecte ... | 2007 | 17665686 |
| nationwide study of dioxins in the freshwater fish carassius auratus (gibelio) langsdorfii (crucian carp) in japan: concentrations and estimation of source contribution ratios. | we investigated dioxin concentrations in freshwater fish in japan by standardizing species to detect subtle decreasing trends of dioxin concentrations in the future with the reinforcement of regulations. the fish studied were crucian carp (carassius auratus (gibelio) langsdorfii), an omnivorous species. fish and sediments were collected from 14 rivers and lakes located in remote areas, agricultural areas, and small and large cities throughout japan. the total toxic equivalent (teq) dioxin concen ... | 2007 | 17675214 |
| isolation and characterization of alpha1-proteinase inhibitor from common carp (cyprinus carpio) seminal plasma. | using a three-step procedure, we purified (79 and 51.6-fold to homogeneity) and characterized the two isoforms (a and b) of alpha1-proteinase inhibitor-like protein from carp seminal plasma. the isoforms have molecular masses of 55.5 and 54.0 kda, respectively. these inhibitors formed sds-stable complexes with cod and bovine trypsin, chymotrypsin and elastase. the thirty-three amino acids within the reactive loop slpdtvilnrpflvlivedttksilfmgkitnp were identified for isoform b. the same first ten ... | 2007 | 17681818 |
| the zebrafish erythropoietin: functional identification and biochemical characterization. | in the present study, the zebrafish epo cdna was cloned. the encoded protein displays 90%, 55% and 32% identity to the epo from carp, fugu and human, respectively. through rt-pcr, the expression of zepo mrna was mainly in the heart and liver. in the cos-1 cell transfection experiments, the recombinant zepo-ha protein was efficiently secreted into the culture medium as a glycoprotein and the carbohydrate moiety can be cleaved by the treatment of peptide-n-glycosidase f (pngase f). using the morph ... | 2007 | 17706649 |
| cross-reactivity of human leukocyte differentiation antigen monoclonal antibodies on carp and rainbow trout cells. | three hundred and seventy-seven monoclonal antibodies (mabs) directed against human cd antigens and non-classified human leukocyte surface antigens were assayed for their reactivity with common carp (cyprinus carpio l.) and rainbow trout (oncorhynchus mykiss) peripheral blood leukocytes (pbl) and thymocytes within the animal homologue section of the 8th international workshop on human leukocyte differentiation antigens (hlda8). four of the mabs clearly reacted with rainbow trout pbl and two with ... | 2007 | 17707517 |
| maternal balanced translocation (4;21) leading to an offspring with partial duplication of 4q and 21q without phenotypic manifestations of down syndrome. | we describe an 8-years old female with supernumerary chromosome der(21)t(4;21)(q25;q22) resulting in partial trisomy 4q25-qter and partial trisomy 21(pter-q22). the extra material was originated from a reciprocal balanced translocation carrier mother (4q;21q). karyotyping was confirmed by fish using whole chromosome painting probes for 4 and 21q and using 21q22.13-q22.2 specific probe to rule out trisomy of down syndrome critical region. phenotypic and cytogenetic findings were compared with pre ... | 2007 | 17710874 |
| [organization of olfactory system of the indian major carp labeo rohita (ham.): a study using scanning and transmission microscopy]. | catla catla, labeo rohita, and cirrhinus mrigala are important alimentary fish in india. their reproduction (breeding) depends on season. the fish perceive external factors-stimuli and chemical signals through the olfactory system that plays the key role in the central regulation of reproduction. however, in the available literature, any electron microscopy data on organization of olfactory elements in these fish are absent. we have studied ultrastructure of the olfactory organ in male l. rohita ... | 2007 | 17725034 |
| polymorphism of transferrin of carp seminal plasma: relationship to blood transferrin and sperm motility characteristics. | transferrin (tf) is a major protein of carp (cyprinus carpio) seminal plasma. its relationship with milt quality is unknown. in this study, we sought to determine if tf is polymorphic in carp seminal plasma and if this polymorphism is related to sperm motility characteristics. we screened males of purebred common carp line (polish line r6) for tf polymorphism in blood plasma. the majority of tf genotypes represented only dd and dg variants. we then collected milt from preselected dd and dg genot ... | 2007 | 17728166 |
| genotyping spring viraemia of carp virus and other piscine vesiculo-like viruses using reverse hybridisation. | a simple nylon membrane-based dna macroarray was developed to genotype spring viraemia of carp virus (svcv) and related viruses. twenty-six viruses were genotyped using the array, and the results were confirmed by phylogenetic analysis of a 426 bp partial glycoprotein gene sequence. the array was not only capable of discriminating between the 4 main genogroups of cyprinid vesiculo-type viruses described previously, but also accurately sub-type the svc viruses assigned to genogroup i. the assay o ... | 2007 | 17760389 |
| phylogenetic analysis of spring virema of carp virus reveals distinct subgroups with common origins for recent isolates in north america and the uk. | genetic relationships between 35 spring viremia of carp virus (svcv) genogroup ia isolates were determined based on the nucleotide sequences of the phosphoprotein (p) gene and glycoprotein (g) genes. phylogenetic analysis based on p gene sequences revealed 2 distinct subgroups within svcv genogroup ia, designated svcv iai and iaii, and suggests at least 2 independent introductions of the virus into the usa in 2002. combined p- and g-sequence data support the emergence of svcv in illinois, usa, a ... | 2007 | 17803105 |