Publications
| Title | Abstract | Year(sorted ascending) Filter | PMID Filter |
|---|
| effect of fluorescent dust color on the attractiveness of attractant self-marking devices to the stable fly (diptera: muscidae). | 1984 | 6725745 | |
| general approach to synthesis of chiral branched hydrocarbons in high configurational purity. | configurationally pure (>99.6%) α-methylalkanoic acids have been employed to prepare chiral hydrocarbon semiochemicals. the stereoisomers of the following compounds were synthesized: 13-methylhentriacontane, 15-methyltritriacontane, and 15,19-dimethyltritriacontane. the first compound was identified earlier as a kairomone of the corn earworm while the other two are sex excitants of the stable fly. the methods described have broad applicability in asymmetric synthesis. | 1984 | 24318739 |
| polyunsaturated hydrocarbons in the stable fly. | three triply-unsaturated hydrocarbons were identified from cuticular lipids of male and mixed-sex stable flies,stomoxys calcitrans. the major compound, (z,z)-1,7,13-pentacosatriene, and two minor compounds, (z,z)-1,7,13-tetracosatriene and (z,z)-1,7,13-tricosatriene, were synthesized. samples of male and female stable flies that differed in age, seasonality, geographic origin, rearing conditions of adults, and methods of extraction were analyzed for the presence of these triolefins. females were ... | 1985 | 24311241 |
| [ultrafine structure of the malpighian tubules of hematophagous diptera]. | the ultrastructure of malpighian tubes of 5 species of bloodsucking diptera was studied: culicoides pulicaris, tabanus bromius, hybomitra schineri, haematopota pluvialis and stomoxys calcitrans. the malpighian tubes of the above species include the cells of two types. the most abundant cells of the 1st type contain many spherical inclusions which represent deposits of mineral compounds. the microvilli of the 1st type cells always contain mitochondria. cells of the 2nd type are characterized by a ... | 1985 | 3975070 |
| cross-reaction of tick salivary antigens in the boophilus microplus-cattle system. | calves were immunized with boophilus microplus saliva, filtered through millipore membranes, in freund's complete adjuvant. serum samples were tested by passive hemagglutination against babesia bigemina, anaplasma marginale, b. microplus larvae extract, stomoxys calcitrans extract and b. microplus saliva. after immunization, titers to saliva, larval tick-extract and to s. calcitrans were increased. the challenge with live tick larvae enhanced the formation of antibodies against larva extract, fl ... | 1985 | 3992881 |
| role of insects in the transmission of bovine leukosis virus: potential for transmission by stable flies, horn flies, and tabanids. | the ability of stable flies (stomoxys calcitrans), horn flies (haematobia irritans), and tabanids (diptera: tabanidae) to transmit bovine leukosis virus (blv) was investigated. stable flies and horn flies were fed on blood collected from an infected cow, and the flies' mouthparts were immediately removed, placed in rpmi-1640 medium, ground, and inoculated into sheep and calves. infection of sheep occurred with mouthparts from as few as 25 stable flies or 25 horn flies. however, sheep were not in ... | 1985 | 2982293 |
| systemic activity of closantel for control of lone star ticks, amblyomma americanum (l.), on cattle. | cattle were treated once at 5 mg/kg orally or subcutaneously or daily at 0.1-5 mg/kg orally or 0.1-1 mg/kg subcutaneously with closantel, n-[5-chloro-4-[(4-chlorophenyl)cyanomethyl]-2-methylphenyl]-2-hydroxy-3, 5-diiodobenzamide, and numbers and weights of engorged females, weights of egg masses and hatch of eggs of lone star ticks, amblyomma americanum, were recorded. effectiveness of treatments on reproduction was determined by comparing total estimated larvae (el) (el = wt. egg mass x est. % ... | 1985 | 3870959 |
| systemic activity of a benzimidazoline compound in cattle against ticks and biting flies. | a benzimidazoline compound [4-nitro-2-(1,1,2,2-tetrafluoroethyl)-6 -(trifluoromethyl)-1h-benzimidazol-2-, 01, sodium salt] referred to as el-979 showed systemic acaricidal and insecticidal activity in cattle against 2 tick species, amblyomma maculatum (gulf coast tick) and dermacentor variabilis (american dog tick) and adult stomoxys calcitrans (stable flies). larvae of black blow fly (phormia regina) were fed serum collected from treated calves. a complete kill of larvae was obtained with a ser ... | 1985 | 4002603 |
| dispersal of adult stomoxys calcitrans (l.) (diptera: muscidae) from known immature developmental areas. | 1985 | 4008745 | |
| mechanical transmission of rift valley fever virus by hematophagous diptera. | experimental studies were conducted to determine if hematophagous diptera were capable of mechanical transmission of rift valley fever (rvf) virus to laboratory animals. all species tested (glossina morsitans, aedes aegypti, aedes taeniorhynchus, culex pipiens, stomoxys calcitrans, lutzomyia longipalpis, and culicoides variipennis) mechanically transmitted the virus to hamsters. mechanical transmission rates for g. morsitans ranged from 0-100%, with the probability of mechanical transmission pos ... | 1985 | 3970308 |
| physiological and nutritional response of beef steers to infestations of the stable fly (diptera: muscidae). | 1986 | 3771911 | |
| use of a genetic technique for separating the sexes of the stable fly (diptera: muscidae). | 1986 | 3771912 | |
| insect transmission of capripoxvirus. | capripoxvirus was transmitted between sheep using stomoxys calcitrans as a vector. attempts to transmit capripoxvirus between sheep and between goats using biting lice (mallophaga species), sucking lice (damalinia species), sheep head flies (hydrotaea irritans) and midges (culicoides nubeculosus) were unsuccessful, although capripoxvirus was isolated from sheep head flies that had previously fed on infected sheep. | 1986 | 3010413 |
| [a stomoxys calcitrans outbreak on a dairy farm]. | in late summer and autumn of 1982 stomoxys calcitrans disturbed cattle on a dairy farm and scourged the people working there. both actively and passively stomoxys calcitrans got into the cowsheds from its nearby breeding sites on open silos. the successful fly control combined sanitary measures with the application of pyrethrum insecticide aerosol. | 1986 | 3717689 |
| effect of host behaviour on host preference in stomoxys calcitrans. | field observations suggest that, in the u.k., cattle are the preferred host of stomoxys calcitrans (l.), followed by horses. differences were observed in the numbers of flies feeding on individual animals both in the field and under controlled conditions. analysis of the behaviour of four friesian calves under attack from s. calcitrans in controlled conditions revealed that the differences in the levels of attack between individual hosts are dependent on the reactions of the host when under atta ... | 1987 | 2979520 |
| effect on milk production of controlling muscid flies, and reducing fly-avoidance behaviour, by the use of fenvalerate ear tags during the dry period. | fenvalerate ear tags reduced fly loads on dry dairy cattle by 95% between july and september. fly dislodging behaviour, such as ear flicks which correlated with numbers of musca autumnalis on the face and stamps/kicks which correlated with numbers of stomoxys calcitrans on the legs, was also significantly reduced. there was no significant difference between the tagged and untagged groups in the total time spent grazing each day. milk yields were not statistically significantly different, but the ... | 1987 | 3597919 |
| physiological and nutritional response of beef steers to combined infestations of horn fly and stable fly (diptera: muscidae). | 1987 | 3571696 | |
| intestinal myiasis in a baby attending a public health clinic. | this article describes a case of intestinal myiasis--the presence of fly larvae in the intestines--in a 12-month-old baby. the asymptomatic child was twice treated by her physician for a presumptive diagnosis of pinworm infection. the mother continued to see "worms" in the child's stool and brought her to a public health primary care clinic where she was evaluated by nurse practitioners. larvae (maggots) of the false stable fly, muscina stabulans, were identified in each of two stool specimens c ... | 1987 | 3587779 |
| electrophoretic comparisons of isozymes from selected populations of stomoxys calcitrans (diptera: muscidae). | 1987 | 3820240 | |
| mechanical transmission of capripox virus and african swine fever virus by stomoxys calcitrans. | stomoxys calcitrans can act as an efficient mechanical vector of capripox virus and african swine fever virus. capripox virus was transmitted to a susceptible goat by flies infected 24 hours previously and the virus survived in some flies for at least four days. african swine fever virus was transmitted to susceptible pigs by flies infected one hour and 24 hours previously and the virus survived in these flies for at least two days without apparent loss of titre. | 1987 | 2820006 |
| mechanical transmission of bacillus anthracis by stable flies (stomoxys calcitrans) and mosquitoes (aedes aegypti and aedes taeniorhynchus). | we evaluated the potential of stable flies, stomoxys calcitrans, and two species of mosquitoes, aedes aegypti and aedes taeniorhynchus, to transmit bacillus anthracis vollum 1b mechanically. after probing on hartley guinea pigs with a bacteremia of ca. 10(8.6) cfu of b. anthracis per ml of blood, individual or pools of two to four stable flies or mosquitoes were allowed to continue feeding on either uninfected guinea pigs or a/j mice. all three insect species transmitted lethal anthrax infection ... | 1987 | 3112013 |
| quantitative evidence for merocrine secretion in insect midgut cells. | the occurrence of apical extrusions from cells has been observed on a large number of occasions in a wide variety of histological investigations. but whether the extrusions observed are a normal physiological event or are artefacts of the experimental procedures adopted has been the subject of much controversy. lehane (1976a) described the extrusion of apical portions of the opaque zone midgut cells of stomoxys calcitrans which contained large numbers of storage granules (merocrine secretion). t ... | 1987 | 18620209 |
| size of secretory granules from midgut cells of the stablefly, stomoxys calcitrans. | the size frequency distribution and number of secretory granules in the opaque zone midgut cells of the stablefly stomoxys calcitrans have been determined using several independent methods. average mean secretory granule diameter is 0.45 microm. mean number of secretory granules per cell is 28,560. the diameter of the granules is compared to the size of secretory granules found in complementary vertebrate tissues and the consequences for the cell of the differences in the size of the granules is ... | 1988 | 18620243 |
| evaluation of the stable fly (stomoxys calcitrans) as a vector of enzootic bovine leukosis. | experiments reported here were directed at 2 questions: (1) can the stable fly (stomoxys calcitrans) transmit enzootic bovine leukosis? (2) could early viremia augment the probability of transmission by this insect? in one vector experiment, calves and bovine leukemia virus (blv)-infected cows were housed with and without stable flies. the calves were monitored serologically during a 3-month postexposure period, using the agar gel immunodiffusion test. all fly-infested and fly-free calves remain ... | 1988 | 2851955 |
| an improved alsynite trap for stable flies, stomoxys calcitrans (diptera: muscidae). | 1988 | 3193434 | |
| vinyl plastic cage design for single-mating experiments to chemosterilize the stable fly (diptera: muscidae) with bisazir. | 1988 | 3351084 | |
| horse-baited insect trap and mobile insect sorting table used in a disease vector identification study. | a horse-baited trap and a mobile insect sorting table were used to conduct an arthropod survey for potential vectors of potomac horse fever in southern maryland and northern virginia. the trap and table worked effectively for the live collection and sorting of haemophagous diptera such as: simulium spp., stomoxys calcitrans, musca autumnalis, tabanus spp. and chrysops spp. during the diurnal collections periods, and culicoides spp. during the crepuscular periods. the trap was not as convenient f ... | 1988 | 2906356 |
| early season dispersal of muscidifurax zaraptor (hymenoptera: pteromalidae) utilizing freeze-killed housefly pupae as hosts. | the pteromalid wasp, muscidifurax zaraptor kogan and legner, was released at three locations at a dairy in may before housefly and stable fly breeding had begun. freeze-killed housefly pupae were placed adjacent to the emerging parasites at biweekly intervals for a 6-week period. hosts placed out weeks 0 and 2 were heavily parasitized. decreased parasitism in hosts placed out at week 4 suggested that many of the m. zaraptor had dispersed or died. high parasitism of hosts placed in the field at w ... | 1988 | 2980169 |
| why is alsynite fiber glass sheet attractive to stable flies? optical and behavioural studies. | the fiber glass material alsynite (sequentia corporation) is known to be an effective visual attractant to stable flies, stomoxys calcitrans. the basis for this attractiveness is not certain, but is found to correlate with high near-uv reflectivity. while examining the transmission properties of alsynite, it was found that the ratio of short- to long-wavelength photons shifts from 0.17 to 0.77, depending on the angle of the alsynite relative to the source and the detector. this shift occurs sudd ... | 1989 | 2776864 |
| control of haematophagous flies on equines with permethrin-impregnated eartags. | the efficacy of 10% (w/w) permethrin impregnated eartags for the control of the haematophagous fly pests stomoxys calcitrans l., haematopota dissimilis meigen and hippobosca maculata leach on equines in india was determined. the tags were found to be effective for 1-2 months against s. calcitrans and h. dissimilis but completely ineffective against h. maculata. no tags were lost during the study. tags can be used as part of an integrated control programme. this is the first reported use of earta ... | 1989 | 2519656 |
| [the distribution of stomoxys calcitrans (diptera, muscidae) in stables]. | cowsheds and pigsties were studied for infestation with the stable fly. 81.5% of the cowsheds, but only 20% of the pigsties were found to be infested. both people working in the sheds and sties and villagers felt molested. the control of the stable fly proved to be not difficult. | 1989 | 2729650 |
| effect of experimental bedding treatments on the density of immature musca domestica and stomoxys calcitrans (diptera: muscidae) in outdoor calf hutches. | experimental bedding materials and a novel delivery method of cyromazine (larvadex) were evaluated as replicated treatments in outdoor calf hutches for effect on the density of immature musca domestica l. and stomoxys calcitrans (l.). in 6-wk trials, overall density of musca domestica l. and stomoxys calcitrans (l.) in straw bedding averaged 36.2 and 52.6 maggots/liter, respectively, compared with respective average densities of 9.0 and 16.2 for wood chips and 10.4 and 20.0 for wood chips over a ... | 1989 | 2768642 |
| costs of existing and recommended manure management practices for house fly and stable fly (diptera: muscidae) control on dairy farms. | costs of fly control practices were estimated for 26 new york and maryland dairy farms. objectives were to characterize existing practices, compare them with the cost of more frequent and complete manure removal to reduce fly breeding, and to compare costs of manure removal and insecticide application. information was collected in scouting visits and personal interviews of farm operators. equipment, labor, and bedding costs were included for manure removal. insecticide application costs included ... | 1989 | 2768644 |
| polyfluoro 1,3-diketones as systemic insecticides. | a series of aryl polyfluoro 1,3-diketones were examined for systemic ectoparasiticidal activity in cattle. the compounds demonstrated efficacy against several economically important species of insects and acarina. at dosages of 5 mg/kg x1 or 0.35 mg/kg per day intraruminally, activity was observed against blowfly larvae (phormia regina), adult stable fly (stomoxys calcitrans), and lone star tick (amblyomma americanum). in vivo activity was not directly related to in vitro activity, showing a str ... | 1989 | 2769686 |
| the intracellular pathway and kinetics of digestive enzyme secretion in an insect midgut cell. | the opaque zone cells of the midgut of the stablefly, stomoxys calcitrans display a cyclical series of ultrastructural events in response to feeding, which it has been suggested are related to the synthesis and secretion of digestive enzymes. these cells have been studied in vivo using a combination of biochemical, morphometric and electron microscopical autoradiographic techniques. the cyclical nature, timing and relationship of the ultrastructural events to enzyme secretion has been confirmed. ... | 1989 | 2772906 |
| flight behavior of musca domestica and stomoxys calcitrans (diptera: muscidae) in a kansas dairy barn. | aerial density, flight thresholds, and periodicity were estimated for the house fly, musca domestica l., and the stable fly, stomoxys calcitrans (l.), from data collected by suction traps located in a dairy barn in kansas between 1 july and 31 october 1970. m. domestica catches increased from july to august, declining to near zero by the end of october. s. calcitrans catches peaked in july and september with a major decline in august. both species exhibited a diel periodicity in flight with maxi ... | 1989 | 2585444 |
| azadirachtin as a larvicide against the horn fly, stable fly, and house fly (diptera: muscidae). | effects of azadirachtin, a triterpenoid extracted from neem seed, azadirachta indica a. juss., were similar to those of insect growth regulators against the immature stages of the born fly, haematobia irritans (l.), the stable fly, stomoxys calcitrans (l.), and the house fly, musca domestica l. when an ethanolic extract of ground seed was blended into cow manure, lc50 and lc90's for larval horn flies were 0.096 and 0.133 ppm azadirachtin, respectively. an emulsifiable concentrate (ec) had an lc5 ... | 1989 | 2600264 |
| parasites that attack stable fly and house fly (diptera: muscidae) puparia during the winter on dairies in northwestern florida. | throughout the winter and early spring months, stable fly, stomoxys calcitrans (l.), and house fly, musca domestica l., puparia were collected from silage, hay, and manure from six dairies in northwestern florida and evaluated for parasitism. of the puparia producing flies or parasites, 23% of the stable flies and 46% of the house flies were parasitized. the predominant parasite observed attacking muscoid flies (76% for stable flies and 58% for house flies) was spalangia cameroni perkins. muscid ... | 1989 | 2708626 |
| walk-through trap for control of horn flies (diptera: muscidae) on pastured cattle. | a walk-through fly trap designed in 1938 by w. g. bruce was tested for two field seasons in missouri. screened elements along both sides of the device functioned as cone traps, thereby catching horn flies, haematobia irritans (l.), as they were swept from cattle by strips of carpet hung from the roof. horn fly control on pastured cattle averaged 54 and 73% when they were afforded access to the trap. analyses of diptera captured in the trap indicated that horn flies comprised the most abundant sp ... | 1989 | 2708630 |
| relative attractiveness of paired bl and blb fluorescent bulbs for house and stable flies (diptera: muscidae). | blacklight (bl) and blacklight blue (blb) fluorescent bulbs were combined in an electrocuting fly trap and compared with bl or blb bulbs alone for fly attraction. combinations of bl and blb bulbs did not attract more house flies, musca domestica, or stable flies, stomoxys calcitrans than were attracted by bl bulbs used alone. | 1989 | 2708631 |
| commercial and naturally occurring fly parasitoids (hymenoptera: pteromalidae) as biological control agents of stable flies and house flies (diptera: muscidae) on california dairies. | filth fly parasites reared by commercial insectaries were released on two dairies (mo, dg) in southern california to determine their effect on populations of house flies, musca domestica l., and stable flies, stomoxys calcitrans (l.). spalangia endius walker, muscidifurax raptorellus kogan and legner, and muscidifurax zaraptor kogan and legner were released on the mo dairy from 1985 to 1987 in varying quantities. parasitism by muscidifurax zaraptor on the mo dairy was significantly higher (p les ... | 1990 | 2376639 |
| comparative attraction of four different fiberglass traps to various age and sex classes of stable fly (diptera: muscidae) adults. | an alsynite cylinder trap and three different williams cross-configuration traps with three adhesives were compared to determine their relative attraction to stable fly, stomoxys calcitrans (l.), adults. williams traps coated with olson sticky stuff performed as well as williams traps coated with tack trap, thus allowing fly samples collected with either adhesive to be compared. the cylinder trap captured fewer total flies, but more flies per cm2 than any of the williams traps. sex ratio of flie ... | 1990 | 2376640 |
| salinity tolerance of stable fly (diptera: muscidae). | effects of salinity on the survival, growth, and development of stable fly, stomoxys calcitrans (l.), were investigated in the laboratory. larvae failed to develop to pupation when reared in media containing a salinity of 40 parts per thousand (ppt) sodium chloride (nacl). maximum salinity supporting larval development equaled the salinity of seawater (34 ppt); the larval lc90 was 24.2 ppt. deleterious effects of high salinity decreased as larvae matured. six-day-old larvae reared at a salinity ... | 1990 | 2376641 |
| attempted transmission of ehrlichia risticii (rickettsiaceae) with stomoxys calcitrans (diptera: muscidae). | experimental transmission of ehrlichia risticii, the causal agent of potomac horse fever, was attempted with adult stable flies, stomoxys calcitrans, (l.) using two feeding schedules. in schedule a, a set of 140 flies was allowed to feed once on an experimentally infected donor pony and once 24 h later on a recipient pony. a different set of flies was used each day for a 12-d period. in schedule b, 240 flies were allowed to feed once daily for 12 consecutive d on the donor pony followed by five ... | 1990 | 2231623 |
| [intestinal myiasis in macao]. | six cases of intestinal myiasis were diagnosed in macao from january 1987 to august 1989, during a survey of intestinal parasites in inhabitants and on stool routine examination in hospitalized patients. the species of flies identified were stomoxys calcitrans in 4 cases and megalesia (megalesia) insulana in 2 cases, m. insulana being a new record in mainland of china. during the survey of intestinal parasites 1889 human fecal samples were collected from chinese inhabitants. 45 samples were coll ... | 1990 | 2096003 |
| effects of host age, host density and parent age on reproduction of the filth fly parasite urolepis rufipes (hymenoptera: pteromalidae). | urolepis rufipes ashmead, a pteromalid wasp, was recently discovered parasitizing house fly and stable fly pupae in eastern nebraska dairies. studies have been conducted on the biology of this parasite to evaluate its potential as a biological control agent of stable flies (stomoxys calcitrans (l.] and house flies (musca domestica l.). house fly pupae were suitable as hosts for u.rufipes at all ages; however, significantly higher parasitism occurred on host pupae aged 96-120 h. parasite-induced ... | 1990 | 2132989 |
| hydrolysis of sphingomyelin and phosphatidylcholine by midgut homogenates of the stable fly. | qualitative and quantitative analyses were made to characterize the enzymatic degradation of sphingomyelin and phosphatidylcholine by midgut homogenates of the adult stable fly, stomoxys calcitrans (l.). the results indicated that sphingomyelin was hydrolyzed by an enzyme with sphingomyelinase-like properties, and that phosphatidylcholine was hydrolyzed by an enzyme with properties similar to phospholipase c. the optimum ph for the sphingomyelinase was 7.6, and the rate of hydrolysis of sphingom ... | 1990 | 2134166 |
| experimental transmission of bovine leukosis virus by leucocytes recovered from the stable fly stomoxys calcitrans l. | 1. wild stable flies (stomoxys calcitrans) feeding on heifers infected with bovine leukosis virus (blv) carried viable bovine leucocytes in the midgut and proboscis that, when inoculated by the subcutaneous route into lambs aged 5 to 60 days, elicited the development of antibodies to glycoprotein (gp51) and polypeptide 25 (p25). 2. antibodies were detected as early as one month later and persisted for an experimental period of 24 or 36 months. uninoculated control lambs reared together with the ... | 1991 | 1665724 |
| suppressing immature house and stable flies in outdoor calf hutches with sand, gravel, and sawdust bedding. | sand, gravel, sawdust, and pine shavings were used as bedding in outdoor calf hutches and compared with straw relative to the density of immature (maggot) house flies, musca domestica, and stable flies, stomoxys calcitrans. in 6-wk field trials, average densities of house and stable fly maggots in concrete mix sand ranged from only .3 to 1.6 and 0 to .1 maggots/l, respectively; pea size gravel bedding also strongly suppressed densities from less than .1 to .3 and less than .1 to .1 maggots/l, re ... | 1991 | 1757634 |
| origin of stable flies (diptera: muscidae) on west florida beaches: electrophoretic analysis of dispersal. | stable fly adults were collected from 16 locations within the state of florida and from locations in six other states in an attempt to determine the source of stable fly populations along florida beaches on the gulf of mexico. electrophoretic analyses were made of a minimum of 10 enzymes in each of 37 separate populations. extremely low heterozygosity resulted in an inability to use standard genetic identity and distance procedures for determining the divergence of allopatric populations to esta ... | 1991 | 1770514 |
| battery-powered, electrocuting trap for stable flies (diptera: muscidae). | a solar-charged, battery-powered, electrocuting grid was combined with a white plywood base to make a portable, pulsed-current, pest-electrocuting device that attracted and killed stable flies, stomoxys calcitrans (l.), outdoors. the grid was powered once every 1-2 s by a 0.016-s pulse of 60-hz alternating current of 4 ma and 9,500 v. power was turned off at night by a photoresistor. the trap functioned continuously for 14 d with an unrecharged 12-v, 18a/h lawn-tractor battery and killed as many ... | 1991 | 1770518 |
| physiological and nutritional responses of beef steers exposed to stable flies (diptera: muscidae). | physiological and nutritional responses were measured in beef steers exposed to laboratory infestations of stable flies, stomoxys calcitrans (l.). calves (n = 6 per treatment) were infested with four levels of stable flies for three periods daily (15 min each period) for 14 d. steers exposed to 0, 10, 20, or 30 stable flies consumed similar amounts of feed and water; they excreted similar amounts of feces and urine throughout the study. during the experiment, changes in body weight were not infl ... | 1991 | 1842798 |
| landing pattern of stable flies (diptera: muscidae) on the alsynite cylinder trap: effect of wind speed and direction. | the distribution of stable flies, stomoxys calcitrans (l.), caught on adhesive-coated alsynite cylinder traps indicated that a significantly higher proportion of flies landed on the side most protected from the wind, and that flies were distributed equally on both sides of the traps bisected by the direction of the prevailing wind, and that the proportion of trapped flies decreased significantly with height on the trap. the landing pattern of house flies, musca domestica l., appeared to differ f ... | 1991 | 1941944 |
| developmental sites and relative abundance of immature stages of the stable fly (diptera: muscidae) in beef cattle feedlot pens in eastern nebraska. | a 3-yr study was done to determine where and at what relative frequency stable fly, stomoxys calcitrans (l.), immatures develop in beef cattle feedlot pens and the relationship of stable fly immature versus adult sample densities. pens within feedlots were divided into five areas (the feed apron, back fence, side fences, mound, and the general lot); from each area, three core samples were randomly taken weekly. in 1986 and 1987, the feed apron yielded the most immature stable flies (62.5%). the ... | 1991 | 2019682 |
| infectivity of serratia marcescens (eubacteriales: enterobacteriaceae) in stomoxys calcitrans (diptera: muscidae). | serratia marcescens bizio, a facultative pathogen of insects, was isolated from stable flies, stomoxys calcitrans (l.), collected from nebraska beef cattle feedlots and dairies. infection rates in laboratory-reared stable flies infected by topical exposures to the bacterium were 57 and 64% in two experiments. per os exposures to sucrose and water solutions, and bovine blood inoculated with s. marcescens, produced mortality rates of about 45 and 10%, respectively. | 1991 | 2033614 |
| pinocembrine: a bioactive flavanone from teloxys graveolens. | bioactivity directed fractionation of the acetone extract of teloxys graveolens (willd.) weber (chenopodiaceae), using the brine shrimp lethality test, led to the isolation of 5,7-dihydroxyflavanone (pinocembrine) (lc50 = 4.25 micrograms/ml) as the only active compound. pinocembrine also exhibited fasciolicide, ovicide and larvicide activities on newly excysted fasciola hepatica, on infective eggs of ascaridi galli and on stage three larvae of stomoxys calcitrans, respectively. | 1991 | 2056764 |
| transmission of bovine virus diarrhoea virus by blood feeding flies. | three species of blood-feeding flies (stomoxys calcitrans, haematopota pluvialis and hydrotaea irritans) were fed for five minutes on a bullock persistently infected with bovine virus diarrhoea virus (bvdv) containing 10(4.5)tcid50 non-cytopathic bvdv/ml serum, then subsequently fed on bvdv-free seronegative animals maintained in isolation. virus was isolated from recipient animals between days 5 and 10 using h pluvialis, and up to 72 hours after transmission with s calcitrans; virus isolation w ... | 1991 | 1850184 |
| localization of leucomyosuppressin-like peptides in the central nervous system of the stable fly with immunocytochemistry. | an antiserum raised against leucomyosuppressin (lms), the first insect neuropeptide shown to inhibit contraction of both visceral and skeletal muscles of insects, revealed the presence of lms-like material in neurons of the adult stable fly, stomoxys calcitrans (l.). cells and their processes immunoreactive to the lms antiserum were found in the brain, subesophageal, and thoracico-abdominal ganglia, with the majority of these neurons in the thoracico-abdominal ganglion. positive immunostaining a ... | 1991 | 1941941 |
| immunological and feeding studies on antigens derived from the biting fly, stomoxys calcitrans. | pairs of rabbits were immunised with three antigenic preparations derived from stomoxys calcitrans gut, abdominal section and whole flies. immunoblotting studies demonstrated that a humoral response was mounted against eight antigens from the gut preparation and 12 each from the abdominal and whole fly preparations. in vitro feeding experiments showed higher mortality between days 4 and 7 in the group of flies which had fed upon blood from rabbits inoculated with the gut derived antigen. this gr ... | 1992 | 1441185 |
| new diets for production of house flies and stable flies (diptera: muscidae) in the laboratory. | a diet for rearing the house fly, musca domestica (l.), was developed from feed constituents available on a year-round basis in gainesville, fl. the diet, called the gainesville house fly diet, performed as well or better than the chemical specialties manufacturers' association fly larval medium (csma) and can be mixed, bagged, and delivered by a local feed mill within 3 d. by adding pelleted peanut hulls 1:1 by volume, the house fly diet becomes suitable for rearing the stable fly, stomoxys cal ... | 1992 | 1464690 |
| [use of parasitic wasps (hymenoptera: pteromalidae) in the biological control of domestic flies in pig housing]. | adaptability of two parasitoid species s. nigroaenea and m. zaraptor to conditions of stable microclimate was investigated in a farrowing house. the colony was reared in an insectary at a temperature of 24-26 degrees c and relative humidity of 60-70% in cages of the size 0.3 x 0.3 x 0.2 m. the development of the species m. zaraptor from egg to adult lasted 19 to 23 days, in s. nigroaenea it was 23 to 25 days. rates of parasitism of house fly pupae were followed in plastic pots (8 x 4 x 9 cm) wit ... | 1992 | 1481340 |
| insects feeding on desert bighorn sheep, domestic rabbits, and japanese quail in the santa rosa mountains of southern california. | desert bighorn sheep (ovis canadensis cremnobates), a domestic rabbit (oryctolagus cuniculus), and japanese quail (coturnix japonica) were used as bait animals to collect blood-feeding flies in an area of active blue-tongue and epizootic hemorrhagic disease virus transmission. precipitin tests were used to confirm the blood source where feasible. eight species of culicoides, members of the leptoconops kerteszi group, simulium spp., anopheles franciscanus, and stomoxys calcitrans were collected f ... | 1992 | 1512887 |
| binomial sampling for pest management of stable flies (diptera: muscidae) that attack dairy cattle. | a binomial sampling plan for pest management of the stable fly, stomoxys calcitrans (l.), was developed. counts of stable flies on front legs of the same animal were independent and each leg from the same animal was considered a sample unit. the relationship between the mean number of flies per leg and the variance was determined and did not vary among farms. the relationship between the mean number of flies per leg and the proportion of legs with zero, one or less, and two or less flies (p0, p1 ... | 1992 | 1607474 |
| [the absolute number of the stable fly (stomoxys calcitrans) in the buildings of dairy farms]. | in order to estimate the absolute number of stomoxys calcitrans subpopulation in housings of a dairy farm the capture-mark-recapture method has been used. it has been established that the absolute number of s. calcitrans subpopulation can be as high as 100,000 specimens per a farmyard. the possibilities of using indices of the relative number of flies (caught on fly-paper) for estimation of the absolute number of these insects in the housings of farms have been found out. | 1992 | 1297972 |
| [determination of thermal requirements of stomoxys calcitrans (l.) (diptera, muscidae), under laboratory conditions]. | the biology of immature stages of stomoxys calcitrans (l.) was studied in the laboratory under four constant temperatures. the study was carried out in biological incubators at 20, 25, 30 and 35 degrees c; 65 +/- 10% relative humidity and 14 hours of photophase. the most favorable temperature for developing eggs, larval and pupal was 25 degrees c, while 35 degrees c proved to be harmful for a normal developing of s. calcitrans in larval stage. the incubation periods for egg were 69.90, 42.58, 26 ... | 1992 | 1343786 |
| some pharmacological properties of the oviduct muscularis of the stable fly stomoxys calcitrans. | 1. spontaneous and rhythmic contractions were measured in 80% of the preparations of the stable fly oviduct which were separated from the central nervous system and other tissues. measurements of the changes in the amplitude and frequency of contractions and changes in the baseline tonus were taken separately, even though they often occurred together during chemical treatments. 2. l-glutamate, at a concentration of 10(-4) to 10(-3) m, caused an increase in the frequency of contractions and in mu ... | 1992 | 1358541 |
| effects of stable flies (diptera: muscidae) and heat stress on weight gain and feed efficiency of feeder cattle. | cattle respond to the feeding of stable flies, stomoxys calcitrans (l.), by bunching to protect their front legs. this bunching can increase heat stress which indirectly accounts for much of the reduction in cattle weight gains. we used fly-screened, self-contained feedlot pens which allowed regulation of fly populations feeding on cattle. the indirect fly effects (bunching and heat stress) accounted for 71.5% of the reduced weight gain. the direct effect of the biting flies and energy loss invo ... | 1992 | 1401484 |
| on the transmissibility of eperythrozoon suis by stomoxys calcitrans and aedes aegypti. | the stable fly, stomoxys calcitrans (linnaeus), and the yellow fever mosquito, aedes aegypti (linnaeus), were utilized to determine their capability to transmit eperythrozoon suis splitter between swine. three groups of each insect in each trial were allowed to feed on a pig previously infected with e. suis and then transferred to susceptible splenectomized pigs. as a control, one group of each insect was fed on a non-infected pig and then transferred to a susceptible pig. stable flies were tran ... | 1993 | 8291187 |
| solar-powered electrocuting trap for controlling house flies and stable flies (diptera: muscidae). | a portable trap was constructed that was visually attractive to house flies, musca domestica l., and stable flies, stomoxys calcitrans (l.), outdoors. the trap was made of a white and yellow pyramid placed on top of a white vertical base that had large cutouts in each side. attracted flies were killed by means of solar-powered electrocuting grids. three traps killed an average of 1,360 house flies and 1,190 stable flies per day at a manure dump and were effective in attracting flies under both c ... | 1993 | 8254633 |
| seasonal abundance of stable flies and house flies (diptera: muscidae) in dairies in alberta, canada. | seasonal abundance of stable flies and house flies was studied at four dairies in southern alberta, canada, from may to october in 1989, 1990, and 1991. stable flies were active from may to october in all years and showed population peaks in august and september. the weekly rate of change of stable fly populations was influenced by temperature and accumulated degree-days above 10 degrees c. the weekly rate of change of stable fly populations showed four peaks which were attributed to the emergen ... | 1993 | 8254636 |
| effects of two blood-feeding regimes on mortality and female reproduction in a laboratory colony of stable flies, stomoxys calcitrans. | stable flies (stomoxys calcitrans l.) deprived of a bloodmeal until 3 days post-emergence had higher mortality rates than control flies fed from the day of emergence. fat bodies of deprived females required one more bloodmeal to reach maximum size, and maximum size was smaller, than fat bodies of control females. ovarian development did not commence prior to feeding in deprived flies, and proceeded more slowly thereafter, resulting in a one blood-meal delay in egg maturation in deprived flies. d ... | 1993 | 8481526 |
| allozyme variation in stable flies (diptera: muscidae). | polyacrylamide gel electrophoresis was used to resolve allozymes in the cosmopolitan blood-feeding stable fly, stomoxys calcitrans (l.). nineteen of 38 loci were polymorphic (53%). mean heterozygosities among all loci and among only polymorphic loci were 0.096 and 0.182, respectively. these gene diversity measures are about half those among other muscid diptera. variation in gene frequencies was examined in 10 natural stable fly populations from iowa and minnesota. gene frequencies were homogene ... | 1993 | 8259926 |
| average daily gains of brahman-crossbred and english x exotic feeder heifers exposed to low, medium, and high levels of stable flies (diptera: muscidae). | brahman-crossbred and english x exotic feeder heifers were exposed to low (5 per leg), medium (12 per leg), and high (30 per leg) stable fly, stomoxys calcitrans (l.), population levels to test relative tolerance of these cattle breeds to stable flies. the brahman-crossbred heifers were tolerant to stable flies only when they were 12-13 mo old. at the same age, the english x exotic heifers sustained reductions in average daily gain (adg) at all three stable fly population levels of 0.22 kg/d (11 ... | 1993 | 8376651 |
| population dynamics of some synanthropic fly species in different habitats in buraydah, saudi arabia. | the population dynamics of five synanthropic fly species, chrysomyia rufifacies, musca d. domestica muscina stabulans f. sarcophaga haemorrhoidalis, and stomoxys calcitrans, were studied at three different habitats in buraydah, saudi arabia. the chosen habitats were the slaughter house, the cattle market and the rubbish dumps. the number of flies caught per twenty sticky bands was taken monthly, for a whole year, as an index to the fly population at that habitat during that month. m. d. domestic ... | 1993 | 8482859 |
| diethylphenylacetamide: a new insect repellent against stable fly, stomoxys calcitrans. | this paper reports the results of a laboratory study showing effectiveness of a new insect repellent n,n-diethylphenylacetamide (depa) against stable fly, stomoxys calcitrans, and compared to n,n-diethyl-m-toluamide (deet) and dimethyl-phthalate (dmp). depa gave maximum protection time of more than 6 h at 3% concentration followed by deet and dmp. | 1993 | 8369560 |
| description and biology of trichopria painteri n.sp. (hymenoptera: diapriidae), a solitary parasitoid of stomoxys calcitrans (diptera: muscidae) from harare, zimbabwe. | taxonomic description and life history are given of trichopria painteri n.sp. (hymenoptera: diapriidae), a solitary endoparasitoid that emerged from stomoxys calcitrans (l.) (diptera: muscidae) pupae collected at an agricultural installation near harare, zimbabwe, africa. although its low level of parasitism. high immature mortality and short adult life span would require augmentative releases of t.painteri, this parasitoid could reduce isolated field populations of s.calcitrans to an acceptable ... | 1993 | 8268491 |
| retention and attempted mechanical transmission of ehrlichia risticii by stomoxys calcitrans. | the ability of adult stomoxys calcitrans (l.) (diptera: muscidae) to retain viable ehrlichia risticii (rickettsiaceae), the aetiologic agent of potomac horse fever (phf), and mechanically transmit the pathogen from citrated bovine blood artificially infected with e. risticii to susceptible mice was studied. viable e. risticii were found in the digestive tract of s. calcitrans 3 h after the flies had engorged to repletion on infected blood; however, no e. risticii were detected in flies > or = 2 ... | 1994 | 8161843 |
| [the absolute count of the housefly (musca domestica) and the stable fly (stomoxys calcitrans) in buildings for cattle]. | the direct correlative dependence between indices of absolute and relative number of two fly species calculated by peterson's method is shown. the way of calculation of the absolute number of m. domestica and s. calcitrans and the receipt of the selection from subpopulations, which take in account peculiarities of adult fly distribution in different technological regimes of cattle keeping, peculiarities of daily activity and influence of temperature-photo factors on imago, are proposed. the atte ... | 1994 | 7816502 |
| inundative releases of pteromalid parasitoids (hymenoptera: pteromalidae) for the control of stable flies, stomoxys calcitrans (l.) (diptera: muscidae) at confined cattle installations in west central nebraska. | fly pupal parasitoids, primarily muscidifurax raptor girault and sanders and spalangia nigroaenea curtis, purchased from commercial insectaries, failed to reduce numbers of stable fly, stomoxys calcitrans (l.), significantly despite weekly releases of high numbers at one feedlot and one dairy during 1990 and a different feedlot and dairy in 1991. parasitoid emergence from stable fly puparia were not significantly greater in the confinements where releases were made compared with confinements whe ... | 1994 | 8027475 |
| vector control by removal trapping. | the classic approach to vector control where large tracts of land are treated with an insecticide has many shortcomings. these include high cost, chemical resistance of target species to many of the widely used insecticides, a lack of public acceptance, and the detrimental effect of sprays on nontarget species. removal trapping, the use of visual, auditory, and olfactory attractants to lure target species into small areas where they are killed, has recently received well-deserved attention as a ... | 1994 | 8024078 |
| biology and control of tabanids, stable flies and horn flies. | tabanids are among the most free-living adult flies which play a role as livestock pests. a single blood meal is used as a source of energy for egg production (100-1,000 eggs per meal), and females of certain species can oviposit before a blood meal is obtained (autogeny). therefore, the maintenance of annual populations requires successful oviposition by only 2% of females. wild animal blood sources are usually available to maintain annual tabanid populations. larval habitats are also independe ... | 1994 | 7711307 |
| the ability of stomoxys calcitrans and mechanical means to transmit trypanosoma (brucei) evansi from goats to camels in kenya. | 1994 | 7831761 | |
| overwintering of the stable fly (diptera: muscidae) in southeastern nebraska. | adult stable flies, stomoxys calcitrans (l.), were monitored during three winters at two, four, and 13 locations with alsynite fiberglass traps and by examination of the interiors of buildings. no stable flies were found inside buildings during the winter. adult stable flies were consistently caught on alsynite traps at one location during two winters and at two other locations during one winter. distribution and physiological age of these flies indicate that they emerged from pupae that had dev ... | 1994 | 7836614 |
| isolation and characterization of a diuretic peptide common to the house fly and stable fly. | an identical crf-related diuretic peptide (musca-dp) was isolated and characterized from whole-body extracts of the house fly, musca domestica, and stable fly, stomoxys calcitrans. the peptide stimulates cyclic amp production in manduca sexta malpighian tubules and increases the rate of fluid secretion by isolated musca domestica tubules. the 44-residue peptide, with a mol.wt. of 5180, is amidated, and has the primary structure: nkpslsivnpldvlrqrllleiarrqmkentrqvelnrailknv-nh2. musca-dp has a hi ... | 1994 | 7991460 |
| exposure to stable flies reduces spatial learning in mice: involvement of endogenous opioid systems. | biting flies influence both the physiology and behaviour of domestic and wild animals. this study demonstrates that relatively brief (60 min) exposure to stable flies, stomoxys calcitrans (l.), affects the spatial abilities of male mice. stable fly exposure resulted in poorer subsequent performance in a water maze task in which individual mice had to learn the spatial location of a submerged hidden platform using extramaze visual cues. determinations of spatial acquisition and retention were mad ... | 1995 | 7548949 |
| structural characterization of muscles and epithelial sheaths of the oviduct of stomoxys calcitrans (diptera: muscidae). | fine structure of both muscle and epithelial cells in the oviduct of stomoxys calcitrans (l.) was characterized. each tubular section of the oviduct consisted of an inner epithelial sheath enveloped by an outer network of muscle fibers that showed noticeable variation in cross-sectional thickness. some regions consisted of a single cellular layer, whereas others were composed of two or more layers of cells. moreover, a wide variation in muscle fiber orientation was observed, with some cells appe ... | 1995 | 7616524 |
| temperature and population density effects on feeding activity of stomoxys calcitrans (diptera: muscidae) on cattle. | the relationship of population density and temperature to feeding activity of stable flies, stomoxys calcitrans (l.), on cattle was studied by placing cattle in constant temperature chambers with controlled fly density and temperature. the number of flies per front leg declined within hours after release but increased with fly density and temperature. the time flies spent on the host during a 5.5-h exposure period ranged from < 2.5 min at temperature < 16 degrees c to > 34 min when temperature w ... | 1995 | 7650712 |
| spread of lumpy skin disease in israeli dairy herds. | fourteen of the 17 dairy herds in peduyim, an israeli village, became infected with lumpy skin disease during a period of 37 days in august and september 1989. one cow in one neighbouring village and four cows in another neighbouring village also became infected, probably through being treated by a veterinarian who treated cows in peduyim. circumstantial evidence suggests that the original infection was brought to peduyim and spread by stable flies (stomoxys calcitrans) carried by the wind from ... | 1995 | 8533249 |
| skin lesions in dogs, horses and calves caused by the stable fly stomoxys calcitrans (l.) (diptera: muscidae). | specific skin lesions caused by stomoxys calcitrans on the feeding sites of different species are described. skin lesions appeared on dogs, horses and calves following bites of stable flies. necrotic dermatitis was observed in 32 dogs of various breeds at the tip of the ears. exudative dermatitis appeared on the legs of 45 adult horses and dermatitis was diagnosed in the "hair whirlpools" on the backs of 18 white calves. | 1995 | 8734229 |
| intra- and interspecific competition and host race formation in the apple maggot fly, rhagoletis pomonella (diptera: tephritidae). | intra- and interspecific resource competition are potentially important factors affecting host plant use by phytophagous insects. in particular, escape from competitors could mediate a successful host shift by compensating for decreased feeding performance on a new plant. here, we examine the question of host plant-dependent competition for apple (malus pumila)- and hawthorn (crataegus mollis)-infesting larvae of the apple maggot fly, rhagoletis pomonella (diptera: tephritidae) at a field site n ... | 1995 | 28306956 |
| some morphological aspects of the mouthparts of italian blood-sucking muscids (diptera, stomoxyinae). | scanning electron microscopy (sem) observations on the mouthparts of four species of blood-sucking muscid symbovine flies (stomoxys calcitrans linnaeus, haematobia irritans linnaeus, h. titillans bezzi, and haematobosca stimulans meigen) are described. the morphology of some structures (haustellum, prestomal teeth and petiolate blades) is compared in order to draw attention to those features involved in the feeding process on the hosts. | 1996 | 9257341 |
| localization of myosuppressinlike peptides in the hypocerebral ganglion of two blood-feeding flies: horn fly and stable fly (diptera:muscidae). | the insect peptides leucomyosuppressin (pedvdhvflrfamide) and dromyosuppressin (tdvdhvflrfamide) have identical chemical sequences with the exception of the n-terminal amino acid; both inhibit spontaneous contraction of insect visceral muscles. neurons in the hypocerebral ganglion of horn fly, hematobia irritans (l.), and stable fly, stomoxys calcitrans (l.), were found to contain material immunoreactive to antiserum produced against the c-terminal of leucomyosuppressin, but not to the n-termina ... | 1996 | 8667397 |
| phenylpropanoids as attractants for adult stomoxys calcitrans (diptera:muscidae). | rate of capture of stable flies, stomoxys calcitrans (l.), on phenylpropanoid-baited and unbaited sticky traps was determined in tests conducted in a corn field and in grasses adjacent to a dairy farm. phenylpropanoid compounds significantly increased capture in 2 of 4 tests in corn. captures were highest with 3-phenyl-1-propanol, followed closely by hydrocinnamaldehyde (3-phenyl-1-propanal), and more distantly by cinnamyl alcohol. both sexes were trapped, although males predominated approximate ... | 1996 | 8840698 |
| scheduled sanitation to reduce stable fly (diptera: muscidae) populations in beef cattle feedlots. | sanitation has been long recommended as a means of reducing stable fly, stomoxys calcitrans (l.), populations at cattle feedlots, but there is little published research to support this recommendation. in each of the 2 yr of this study, 4 feedlots received complete sanitation and 4 feedlots received no cleaning. the objective was to have the initial cleaning done before 1 june and then to reclean as needed every 2 wk thereafter. the feedlots that were cleaned had significantly fewer flies than th ... | 1996 | 8934824 |
| urine delivery of cyromazine for suppressing house and stable flies (diptera: muscidae) in outdoor dairy calf hutches. | in a series of 4 trials, dairy calves housed in outdoor hutches were administered technical cyromazine daily at rates of 0, 0.1, 0.5, and 1.0 mg/kg body weight. cyromazine was excreted primarily in the urine. the 2 highest rates prevented the development of immature stages of both the house fly, musca domestica l., and the stable fly, stomoxys calcitrans (l.). analysis of calf body tissues for cyromazine and its metabolite, melamine, indicated that highest combined residues ( < or = 0.35 ppm) we ... | 1996 | 8642111 |
| stability of equine infectious anemia virus in aedes aegypti (diptera: culicidae), stomoxys calcitrans (diptera:muscidae), and tabanus fuscicostatus (diptera:tabanidae) stored at -70 degrees c. | equine infectious anemia virus (eiav) was injected intrathoracically into aedes aegypti, stomoxys calcitrans, and tabanus fuscicostatus, and fed to ae. aegypti in suspensions of either artificial blood of eagle's minimum essential medium. insects were stored at -70 degrees c for up to 9 months before testing for the presence of eiav. the viral tissue culture titers detected from stored insects were similar to those from insects tested at time 0. | 1996 | 8827617 |
| toxic effect of ethanolic extract of nerium oleander (apocynaceae) leaves against different developmental stages of muscina stabulans (diptera-muscidae). | nerium oleander (apocynaceae) is evergreen shrubs widely used for ornamental purpose in mediterranean region. the present investigation, revealed for the first time the insecticidal effect of ethanolic extract from leaves of this plant against 2nd instar larvae of the medically important false stable fly muscina stabulans (diptera: muscidae). lc50 of the extract was 113.66 ppm. this dose delayed larval and pupal duration suppressed oviposition and decreased adult longevity of the survivors. morp ... | 1996 | 8754654 |
| an immunocytochemical investigation of trypsin secretion in the midgut of the stablefly, stomoxys calcitrans. | musca domestica trypsin antibody cross-reacts with polypeptide bands of m(r) 25,000 and 30,000 showing proteolytic activity from stomoxys calcitrans midgut extracts. secretory granules from the main enzyme-secreting region, the opaque zone, stained heavily with the trypsin antibody in both unfed and blood-fed flies. heterogeneous staining of granules suggests the unequal distribution of trypsin in secretory granules. this is also consistent with the occurrence of non-parallel secretion, which is ... | 1996 | 8763163 |
| comparison of core sampling and pupal traps for monitoring immature stable flies and house flies (diptera: muscidae) in beef feedlot pens. | core samples and cylindrical pupal traps were used to monitor immature stages of the stable fly, stomoxys calcitrans (l.), and house fly, musca domestica l., from 5 sample areas in beef feedlot pens: the feed apron-soil interface, the back fence, the side (pen dividing) fence, the mound, and the general lot. one feedlot was sampled during 1986, two feedlots were sampled in 1987, and three samples were taken at random from each sample area on each sample date. core samples showed that both popula ... | 1996 | 8934827 |
| structural characterization of peripheral nerve cells and nerve-muscle junctions of the oviduct of stable fly (diptera:muscidae). | fine structure of both peripheral nerve cells and neuromuscular junctions associated with the oviduct of stable fly. stomoxys calcitrans (l.), was described. twelve or more multipolar peripheral neurons were found along major branch nerves that enter the ovipositor. several were suspended in the haemacoel and others were in close proximity to the surface of the oviduct. some peripheral neurons contained an abundance of neurosecretory granules that ranged in size from 32 to 180 nm in diameter. no ... | 1996 | 8667400 |