Publications

TitleAbstractYear
Filter
PMID(sorted descending)
Filter
benefit of polyhexamethylene biguanide in fusarium keratitis.to report a series of 3 patients with soft contact lens-related fusarium keratitis. two of them were treated with the antiamoebic polyhexamethylene biguanide 0.02% (phmb) in combination with antifungal drugs, and 1 patient was treated with phmb as sole antifungal regimen.201222710976
intra-articular injection of voriconazole for fusarium solani arthritis after bone marrow transplantation. 201222705652
inhibitory effects of essential oils of medicinal plants from growth of plant pathogenic fungi.plant cells produce a vast amount of secondary metabolites. production of some compounds is restricted to a single species. some compounds are nearly always found only in certain specific plant organs and during a specific developmental period of the plant. some secondary metabolites of plants serve as defensive compounds against invading microorganisms. nowadays, it is attempted to substitute the biological and natural agents with chemically synthesized fungicides. in the present research, the ...201122702190
evaluation of the antifungal activity of zataria multiflora, geranium herbarium, and eucalyptus camaldolensis essential oils on saprolegnia parasitica-infected rainbow trout (oncorhynchus mykiss) eggs.the purpose of the present study was to evaluate and assess the capability of zataria multiflora, geranium herbarium, and eucalyptus camaldolensis essential oils in treating saprolegnia parasitica-infected rainbow (oncorhynchus mykiss) trout eggs. a total of 150 infected eggs were collected and plated on glucose-pepton agar at 24°c for 2 weeks. the antifungal assay of essential oils against s. parasitica was determined by a macrodilution broth technique. the eggs were treated with essential oils ...201222690761
compost as a source of microbial isolates for the bioremediation of heavy metals: in vitro selection.heavy metal pollution has become a major environmental concern nowadays and the bioremediation of polluted habitats is an increasingly popular strategy due to both its efficiency and safety. a screening and selection protocol based on different composting processes was designed in order to isolate heavy metal-resistant microorganisms. a collection of 51 microorganisms was obtained and most of them showed the capability to tolerate heavy metals in multi-polluted aqueous systems (cd(ii), cr(vi), n ...201222664539
refractory disseminated fusariosis by fusarium verticillioides in a patient with acute myeloid leukaemia relapsed after allogeneic hematopoietic stem cell transplantation: a case report and literature review.fusarium species are among the leading fungal pathogens to cause invasive mould infections in patients with hematopoietic malignancy. the fusarium species most frequently involved in human infections are fusarium solani, fusarium oxysporum and fusarium verticillioides. however, identification is a cumbersome and time-consuming task. fusarium is resistant in vitro to many of the antifungal agents and the management of fusariosis is not well defined.201322659590
onychomycosis due to nondermatophytic molds.although there have been many studies about onychomycosis due to nondermatophytic molds (ndm), few studies about etiologic agents including ndm in onychomycosis have been reported in korea.201222577268
volatile organic compounds produced by the phytopathogenic bacterium xanthomonas campestris pv. vesicatoria 85-10.xanthomonas campestris is a phytopathogenic bacterium and causes many diseases of agricultural relevance. volatiles were shown to be important in inter- and intraorganismic attraction and defense reactions. recently it became apparent that also bacteria emit a plethora of volatiles, which influence other organisms such as invertebrates, plants and fungi. as a first step to study volatile-based bacterial-plant interactions, the emission profile of xanthomonas c. pv. vesicatoria 85-10 was determin ...201222563356
antimicrobial activity of the essential oil of pavonia odorata willd.the essential oil from the rhizomes of pavonia odorata willd was extracted in an yield of 0.2% by hydrodistillation, and screened for antibacterial and antifungal activity against ten bacteria and thirteen fungi using paper disc agar diffusion technique. the oil was found to inhibit the growth of staphylococcus aureus, diplococcus pheumoniae, escherichia coli and klebsiella sp at 0.55 concentration. the oil was also found to inhibit the growth of keratinophilic fungi trichophyton mentagreophytes ...199222556591
experimental model of fusarium solani keratitis in rats.to establish a repeatable rat model of fusarium solani keratitis (f. solani keratitis) that mimicked fungal keratitis in humans.201122553683
effects of cox-2 inhibitor ns-398 on il-10 expression in rat fungal keratitis.to investigate the expression of interleukin-10 (il-10) and the effect of ns-398(cox-2 inhibitor) on the expression of il-10 in fungal keratitis in rats, and analyze its effects on anti-fungus immunity.201122553634
successful medical management of recalcitrant fusarium solani keratitis: molecular identification and susceptibility patterns.fungal keratitis is a rare but sight-threatening infection of the cornea that may be caused by several fungal pathogens. a delay in diagnosis and inadequate treatment may even lead to loss of the affected eye. fungal keratitis is often misdiagnosed as bacterial keratitis because isolation and identification of the fungal pathogen is difficult and requires experience, and fungal growth in culture requires time. in this report, a 14-year-old boy with recalcitrant fusarium solani keratitis, unrespo ...201222528742
evidence for a novel biological role for the multifunctional β-1,3-glucan binding protein in shrimp.β-1,3-glucan binding proteins (βgbps) are soluble pattern recognition proteins/receptors that bind to β-1,3-glucans from fungi cell walls. in crustaceans, βgbps are abundant plasmatic proteins produced by the hepatopancreas, and have been proved to play multiple biological functions. here, we purified and characterized novel members of the βgbp family from the hemolymph of two brazilian shrimps, farfantepenaeus paulensis (fpβgbp) and litopenaeus schmitti (lsβgbp). as observed for other crustacea ...201222525007
ultraviolet induction of antifungal activity in plants.ultraviolet-c irradiation as a method to induce the production of plant compounds with antifungal properties was investigated in the leaves of 18 plant species. a susceptibility assay to determine the antifungal susceptibility of filamentous fungi was developed based on an agar dilution series in microtiter plates. uv irradiation strongly induced antifungal properties in five species against a clinical fusarium solani strain that was responsible for an onychomycosis case that was resistant to cl ...201222509892
fungi associated with scolytogenes birosimensis (coleoptera: curculionidae) infesting pittosporum tobira.the bark beetle scolytogenes birosimensis niijima is suspected to be involved in the decline of pittosporum tobira (thunb. ex murray) aiton in the coastal areas of japan. we isolated fungi from adult s. birosimensis in nine different localities in japan to assess their potential association and predict their contribution to the success of the beetle. results from morphological identification of associated fungi showed that the beetle was associated with fusarium solani and candida spp. furthermo ...201222506997
structural analysis of a new cytotoxic demethylated analogue of neo-n-methylsansalvamide with a different peptide sequence produced by fusarium solani isolated from potato.a novel cytotoxic cyclic pentadepsipeptide, neosansalvamide, was produced by fusarium solani kccm90040 isolated from fusarium -contaminated potato in korea. the molecular formula of neosansalvamide was analyzed as c₃₂h₅₀n₄o₆ by electrospray ionization tandem mass spectrometry and combined structural analysis. the one- and two-dimensional nuclear magnetic resonance and absolute configuration of amino acid spectral data allowed for the resolution of cyclic five subunits linked in the following ord ...201222502643
proteomic analysis of fusarium solani isolated from the asian longhorned beetle, anoplophora glabripennis.wood is a highly intractable food source, yet many insects successfully colonize and thrive in this challenging niche. overcoming the lignin barrier of wood is a key challenge in nutrient acquisition, but full depolymerization of intact lignin polymers has only been conclusively demonstrated in fungi and is not known to occur by enzymes produced by insects or bacteria. previous research validated that lignocellulose and hemicellulose degradation occur within the gut of the wood boring insect, an ...201222496740
endophytic fungi from pigeon pea [cajanus cajan (l.) millsp.] produce antioxidant cajaninstilbene acid.in this study, novel endophytic fungi producing cajaninstilbene acid (csa) from pigeon pea [ cajanus cajan (l.) millsp.] were investigated and screened. csa has prominent pharmacological activities. a total of 110 endophytic fungi isolates were grouped into 8 genera on the basis of morphological characteristics, and csa-producing fungi were screened by liquid chromatography-tandem mass spectrometry (lc-ms/ms). according to its-rdna sequences analysis, the csa-producing fungi were identified as f ...201222494407
a new furoquinoline alkaloid with antifungal activity from the leaves of ruta chalepensis l.bioassay-guided separation with an eye toward antifungal activity led to the isolation of the new alkaloid 5-(1̀,1̀-dimethylallyl)-8-hydroxyfuro[2-3-b] quinoline (1) and the known biscoumarin daphnoretin (2) as the active constituents of the chloroform extract obtained from the leaves of ruta chalepensis. the structures of the metabolites were elucidated on the basis of their spectral characteristics (nmr, uv, and ms) and were compared with the literature. the antifungal activity of the isolated ...201022491304
production of lignocellulose-degrading enzymes employing fusarium solani f-552.in this work, capability of fusarium solani f-552 of producing lignocellulose-degrading enzymes in submerged fermentation was investigated. the enzyme cocktail includes hydrolases (cellulases, xylanases, and proteinases) as well as ligninolytic enzymes: manganese-dependent peroxidase (mnp), lignin peroxidase (lip), and laccase (lac). to our knowledge, this is the first report on production of mnp, lip, and lac together by one f. solani strain. the enzyme productions were significantly influenced ...201222488104
fruit-specific overexpression of wound-induced tap1 under e8 promoter in tomato confers resistance to fungal pathogens at ripening stage.based on high economic importance and nutritious value of tomato fruits and as previous studies employed e8 promoter in fruit ripening-specific gene expression, we have developed transgenic tomato plants overexpressing tomato anionic peroxidase cdna (tap1) under e8 promoter. stable transgene integration was confirmed by polymerase chain reaction (pcr) and southern analysis for nptii. northern blotting confirmed elevated tap1 levels in the breaker- and red-ripe stages of t(1) transgenic fruits, w ...201222462603
antimicrobial activities of rhizomes of polygonatum verticillatum: attributed to its total flavonoidal and phenolic contents.the current study was undertaken to evaluate the rhizomes of polygonatum verticillatum against various pathogenic bacteria and fungi. broad spectrum antibacterial activity was demonstrated by the crude extract of the plant and its subsequent solvent fractions; predominantly against gram-negative bacteria. mics of the extracts against escherchia coli, salmonella typhi and shigella flexeneri were in the range of 1.5-40 μg/ml, 03-06 μg/ml and 03-40 μg/ml, respectively. the only sensitive gram-posit ...201222459478
cytological karyotyping and characterization of a 410 kb minichromosome in nectria haematococca mpi.karyotypes of the cucurbit pathogen nectria haematococca mpi (anamorph fusarium solani f. sp. cucurbitae race 1) was studied using the two standard strains atcc18098 and atcc18099. complete separation of all chromosomes was difficult with pulsed field gel electrophoresis due to both the large size and co-migration of chromosomes. in contrast, cytological karyotyping was done successfully with fluorescence microscopy combined with the germ tube burst method for sample preparation to visualize mit ...201222453120
allergens from fusarium solani identified by immunoblotting in asthma patients in iran.we extracted fusarium solani antigens to evaluate specific anti-f. solani ige in fifty-one patients with asthma (33 men and 18 women) and in 22 non-atopic healthy subjects (15 men and 7 women). f. solani strains were cultured in sabouraud glucose agar and subjected to cell disruption using the freeze-and-thaw method. the obtained cytoplasmic extracts were analysed using sodium dodecyl sulphate-polyacrylamide gel electrophoresis (sds-page). sensitisation to f. solani antigens has been evaluated i ...201222450199
synthesis of a new group of aliphatic hydrazide derivatives and the correlations between their molecular structure and biological activity.in view of the growing demand for new compounds showing biological activity against pathogenic microorganisms, such as pathogenic and phytopathogenic fungi, the objective of this study was to synthesize a new group of aliphatic and aromatic derivatives of hydrazide. in consequence of the reactions observed during synthesis, the resulting compounds retained their linear structure. their structure and lipophilicity, measured by high-performance liquid chromatography (hplc), were analyzed. correlat ...201222441334
novel broad host range shuttle vectors for expression in escherichia coli, bacillus subtilis and pseudomonas putida.novel shuttle vectors named pebp were constructed to allow the gene expression in different bacterial hosts including escherichia coli, bacillus subtilis and pseudomonas putida. these vectors share the inducible promoters p(t7) and p(xyl) and a cos site to enable packaging of plasmid dna into phage, and carry different multiple cloning sites and antibiotic resistance genes. vector pebp41 generally replicates episomally while pebp18 replicates episomally in gram-negative bacteria only, but integr ...201222440389
evaluation of multiplexed pcr and liquid-phase array for identification of respiratory fungal pathogens.invasive fungal infections are the cause of serious morbidity and high mortality in immunocompromised patients. early laboratory diagnostic options remain limited; however, rapid detection and accurate identification may improve outcome. herein, multiplexed pcr followed by liquid-phase array was evaluated for detection and identification of common respiratory fungal pathogens, including aspergillus fumigatus, rhizopus microsporus, scedosporium apiospermum and fusarium solani. the limit of detect ...201222435876
negative correlation between phospholipase and esterase activity produced by fusarium isolates.fusarium species have emerged as one of the more outstanding groups of clinically important filamentous fungi, causing localized and life-threatening invasive infections with high morbidity and mortality. the ability to produce different types of hydrolytic enzymes is thought to be an important virulence mechanism of fungal pathogens and could be associated with the environment of the microorganism. here, we have measured the production of two distinct lipolytic enzymes, phospholipase and estera ...201222415116
effects of lactoferricin b against keratitis-associated fungal biofilms.biofilms are considered as the most important developmental characteristics in ocular infections. biofilm eradication is a major challenge today to overcome the incidence of drug resistance. this report demonstrates the in vitro ability of biofilm formation on contact lens by three common keratitis-associated fungal pathogens, namely, aspergillus fumigatus, fusarium solani, and candida albicans. antifungal sensitivity testing performed for both planktonic cells and biofilm revealed the sessile p ...201222410856
metabolites from aspergillus fumigatus, an endophytic fungus associated with melia azedarach, and their antifungal, antifeedant, and toxic activities.thirty-nine fungal metabolites 1-39, including two new alkaloids, 12β-hydroxy-13α-methoxyverruculogen tr-2 (6) and 3-hydroxyfumiquinazoline a (16), were isolated from the fermentation broth of aspergillus fumigatus ln-4, an endophytic fungus isolated from the stem bark of melia azedarach. their structures were elucidated on the basis of detailed spectroscopic analysis (mass spectrometry and one- and two-dimensional nmr experiments) and by comparison of their nmr data with those reported in the l ...201222409377
use of biocides for the control of fungal outbreaks in subterranean environments: the case of the lascaux cave in france.the lascaux cave in france suffered an outbreak of the fungus fusarium solani in 2001. biocides were applied for three years to control this outbreak. four months after the initial biocide application, a new outbreak appeared in the form of black stains that progressively invaded the cave. the black stains on the ceiling and passage banks were so evident by 2007 that they became one of the cave's major problems. therefore, biocides were used again in 2008. the present study investigated the fung ...201222380699
temperature and moisture effect on spore emission in the fungal biofiltration of hydrophobic vocs.the effect of temperature and moisture on the elimination capacity (ec), co(2) production and spore emission by fusarium solani was studied in biofilters packed with vermiculite and fed with n- pentane. three temperatures (15, 25 and 35°c) were tested and the highest average ec (64 g m(-3) h(-1)) and lower emission of spores (2.0 × 10(3) cfu m(-3) air) were obtained at 25°c. the effect of moisture content of the packing material indicates that the highest ec (65 g m(-3) h(-1)) was obtained at 50 ...201222375544
equine keratomycosis in japan.to describe the incidence, clinical progress, visual outcome, and laboratory findings of equine keratomycosis in japan.201322372681
statistical optimization of medium components for production of extracellular chitinase by basidiobolus ranarum: a novel biocontrol agent against plant pathogenic fungi.the influence of concentration of medium components such as colloidal chitin, lactose, malt extract, yeast extract, and peptone on the chitinase production from basidiobolous ranarum at the flask level were studied by using statistical tool central composite design (ccd) and analysed by response surface methodology (rsm). the results revealed that colloidal chitin, malt extract and peptone had significant effect (p < 0.01) on the chitinase production at their individual levels. the polynomial eq ...201222359366
phylogenomic and functional domain analysis of polyketide synthases in fusarium.fusarium species are ubiquitous in nature, cause a range of plant diseases, and produce a variety of chemicals often referred to as secondary metabolites. although some fungal secondary metabolites affect plant growth or protect plants from other fungi and bacteria, their presence in grain-based food and feed is more often associated with a variety of diseases in plants and in animals. many of these structurally diverse metabolites are derived from a family of related enzymes called polyketide s ...201122289777
functional analysis of fara transcription factor in the regulation of the genes encoding lipolytic enzymes and hydrophobic surface binding protein for the degradation of biodegradable plastics in aspergillus oryzae.fara is a zn(ii)(2)cys(6) transcription factor which upregulates genes required for growth on fatty acids in filamentous fungi like aspergillus nidulans. fara is also highly similar to the cutinase transcription factor ctf1α of fusarium solani which binds to the cutinase gene promoter in this plant pathogen. this study determines whether fara transcriptional factor also works in the regulation of genes responsible for the production of cutinase for the degradation of a biodegradable plastic, pol ...201222280964
molecular cloning and functional analysis of a recombinant ribosome-inactivating protein (alpha-momorcharin) from momordica charantia.alpha-momorcharin (α-mc), a member of the ribosome-inactivating protein (rip) family, has been used not only as antiviral, antimicrobial, and antitumor agents, but also as toxicant to protozoa, insects, and fungi. in this study, we expressed the protein in escherichia coli rosetta (de3) plyss strain and purified it by nickel-nitrilotriacetic acid affinity chromatography. a total of 85 mg of homogeneous protein was obtained from 1 l culture supernatant of rosetta (de3) plyss, showing a high recov ...201222262229
preparation and characterization of dispersible chitosan particles with borate crosslinking and their antimicrobial and antifungal activity.we synthesized new dispersive chitosan particles at circumneutral ph. particles composed of a chitosan-borate complex were synthesized by a method consisting of two simple steps: mixture and dialysis. as this method does not employ reagents such as organic solvents or surface-active agents and does not require heat treatment, it has a minimal negative impact on the environment. crosslinking of the reaction of glucose and boric acid at ordinary temperature and pressure led to the formation of com ...201122261277
antifungal efficacy of soft contact lens disinfecting solutions against fusarium solani and candida albicans.the aim was to evaluate the disinfection properties of six multi-purpose contact lens disinfection solutions (mpds) available in iran against fusarium solani and candida albicans, based on the international organization for standardization (iso) 14729 guidelines.201222260336
deep granulomatous dermatitis of the fin caused by fusarium solani in a false killer whale (pseudorca crassidens).a 10-year-old female false killer whale (pseudorca crassidens) developed skin lesions in the left breast fin. histopathologically, the lesions consisted of multiple granulomas spread diffusely into the deep dermis and bone; characteristically, each granuloma has septate, branching fungal hyphae and chlamydospores surrounded by eosinophilic splendore-hoeppli materials. macrophages, epithelioid cells and multinucleated giant cells in the granulomas reacted mainly to anti-sra-e5 antibody against hu ...201122214860
extracellular xylanase production by fusarium species in solid state fermentation.fusarium sp. has been shown to be a promising organism for enhanced production of xylanases. in the present study, xylanase production by 21 fusarium sp. isolates (8 fusarium culmorum, 4 fusarium solani, 6 fusarium verticillioides and 3 fusarium equiseti) was evaluated under solid state fermentation (ssf). the fungal isolate fusarium solani syrn7 was the best xylanase producer among the tested isolates. the effects of some agriculture wastes (like wheat straw, wheat bran, beet pulp and cotton se ...201122184927
A New Method for Evaluation of Compatibility of Contact Lenses and Lens Cases With Contact Lens Disinfecting Solutions.PURPOSE:: The purpose of this article is to describe new methodology, antimicrobial efficacy endpoint methodology to determine compatibility of contact lens solutions, lens cases and hydrogel lenses for disinfection (AEEMC), to evaluate the effect of a contact lens and a lens case on disinfection efficacy, and to present the ring test used to justify the use of the method in multiple laboratories. MATERIALS AND METHODS:: A prototype solution containing chlorhexidine as the disinfecting agent and ...201222178791
comparative analysis of fusarium mitochondrial genomes reveals a highly variable region that encodes an exceptionally large open reading frame.the mitochondrial (mt) genomes of fusarium verticillioides, fusarium solani and fusarium graminearum were annotated and found to be 53.7, 63.0 and 95.7kb in length, respectively. the genomes encode all genes typically associated with mtdnas of filamentous fungi yet are considerably larger than the mt genome of f. oxysporum. size differences are largely due to the number of group i introns. surprisingly, the genomes contain a highly variable region of 7-9kb that encodes an exceptionally large, un ...201122178648
performance of innovative pu-foam and natural fiber-based composites for the biofiltration of a mixture of volatile organic compounds by a fungal biofilm.the performance of perlite and two innovative carriers that consist of polyurethane (pu) chemically modified with starch; and polypropylene reinforced with agave fibers was evaluated in the biofiltration of a mixture of vocs composed of hexane, toluene and methyl-ethyl-ketone. at a total organic loading rate of 145gcm(-3)h(-1) the elimination capacities (ecs) obtained were 145, 24 and 96gcm(-3)h(-1) for the biofilters packed with the pu, the reinforced polypropylene, and perlite, respectively. s ...201122178276
successful treatment of disseminated fusariosis with voriconazole in an acute lymphoblastic leukaemia patient.fusarium species are actually the second most common pathogenic mould in immunocompromised patients, and it is difficult to treat such fusarial infections with current antifungal agents. we report the case of a 53-year-old woman with philadelphia-positive acute lymphoblastic leukaemia. during induction chemotherapy with febrile neutropenia, she developed a disseminated fusariosis, with persistent fever refractory to antibacterial agents and caspofungin (as empirical therapy), painful skin lesion ...201122126523
stacking of antimicrobial genes in potato transgenic plants confers increased resistance to bacterial and fungal pathogens.solanum tuberosum plants were transformed with three genetic constructions expressing the nicotiana tabacum ap24 osmotine, phyllomedusa sauvagii dermaseptin and gallus gallus lysozyme, and with a double-transgene construction expressing the ap24 and lysozyme sequences. re-transformation of dermaseptin-transformed plants with the ap24/lysozyme construction allowed selection of plants simultaneously expressing the three transgenes. potato lines expressing individual transgenes or double- and tripl ...201122115953
fungal endophthalmitis.fungal endophthalmitis (fe) is infrequent but results in poor visual outcomes. it can be exogenous or endogenous depending upon the mode of infection. the common causes for endogenous fe, post-traumatic fe and fe secondary to keratitis are candida albicans, aspergillus niger and fusarium solani, respectively. clinical features depend on the virulence of the organism and the mode of infection. broad-spectrum systemic antifungal therapy with or without intravitreal antifungal drugs is recommended. ...201122114969
Treatment of Fungal Keratitis From Fusarium Infection by Corneal Cross-Linking.PURPOSE:: To evaluate the efficacy of corneal cross-linking (CXL) (riboflavin-UV-A) as a simple therapy in Fusarium keratitis. METHODS:: Twenty-four rabbits were systemically anesthetized, and the stromata of their right corneas were inoculated with Fusarium solani [10 colony-forming units (CFU) per milliliter]. Rabbits were divided into 2 groups: one was treated with CXL 72 hours after infection and the other did not receive any treatment (control). All eyes in both the groups were examined bef ...201122081155
four plant defensins from an indigenous south african brassicaceae species display divergent activities against two test pathogens despite high sequence similarity in the encoding genes.abstract:201122032337
Supercritical carbon dioxide biocatalysis as a novel and green methodology for the enzymatic acylation of fibrous cellulose in one step.Aliphatic esters of cellulose have recently raised the interest on the field of biopolymers. The objective of this work is to develop a methodology for the enzymatic acylation of cellulose with long chain fatty groups in one step. Therefore we designed a system at which fibrous cellulose was enzymatically acylated with vinyl laurate in supercritical carbon dioxide (scCO(2)) and as a result cellulose laurate was formed. The biocatalysts used for this reaction were immobilized lipase Candida antar ...201122014705
Synthesis, crystal structure, spectroscopic, magnetic, theoretical, and microbiological studies of a nickel(II) complex of L-tyrosine and imidazole, [Ni(Im)2(L-tyr)2]·4H2O.The [Ni(Im)(2)(L-tyr)(2)]·4H(2)O (1) complex was obtained in crystalline form as a product of interaction of L-tyrosine sodium salt, imidazole, and NiSO(4). The X-ray structure was determined, and the spectral (IR, FIR, NIR-vis-UV, HF EPR) and magnetic properties were studied. The Ni(2+) ion is hexacoordinated by the N and O atoms from two L-tyrosine molecules and by two N atoms of imidazole, resulting in a slightly distorted octahedral [NiN(2)N(2)'O(2)] geometry with a tetragonality parameter T ...201122010795
[Identification of soil-borne fungi using Fourier transform infrared spectroscopy].Fourier transform infrared (FTIR) attenuated total reflectance (ATR) spectroscopy was used in combination with multivariate statistic analysis for identification of soil-borne fungi that causes severe economic damage to agriculture: Fusarium monili forme, Fusarium semitectum, Fusarium oxysporum, Fusarium solani, Rhizoctonia solani, Sclerotinia sclerotiorum, Pythium aphanidermatum and Phytophthora capsici. The original FTIR spectra were normalized, and the second derivatives were calculated, from ...201122007392
Resistant Fusarium Keratitis Progressing to Endophthalmitis.OBJECTIVE:: To report a case of multidrug-resistant Fusarium sp keratitis that progressed to endophthalmitis and that eventually required enucleation. METHODS:: Case report and literature review. Isolate identification and susceptibility testing were performed by the Fungus Testing Laboratory at San Antonio, TX. RESULTS:: A 52-year-old soft contact lens wearer had a corneal abrasion and developed a corneal infiltrate. Examination of corneal scrapings revealed filamentous hyphae with septation an ...201121993589
the in-vitro evaluation of antibacterial, antifungal and cytotoxic properties of marrubium vulgare l. essential oil grown in tunisia.in order to validate its antiseptic and anticancer properties with respect to traditional uses, we have screened for the first time the antimicrobial activity of aerial parts of m. vulgare l. essential oil against different pathogenic microorganisms and the cytotoxic activity against hela cell lines.201121936887
detection of invasive infection caused by fusarium solani and non-fusarium solani species using a duplex quantitative pcr-based assay in a murine model of fusariosis.a duplex real time pcr (rt-pcr) assay for detecting dna of members of the genus fusarium has been developed and validated by using two mouse models of invasive infection. the duplex rt-pcr technique employed two specific molecular beacon probes targeting a highly conserved region of the fungal rdna gene. this technique showed a detection limit of 10 fg dna per μl of sample and a specificity of 100%. the sensitivity in a total of 48 samples from a murine model of fusarium solani infection was 93. ...201121905946
Alpha2-macroglobulin from an Atlantic shrimp: biochemical characterization, sub-cellular localization and gene expression upon fungal challenge.In this study, we report on the isolation and characterization of an alpha2-macroglobulin (a2M) from the plasma of the pink shrimp Farfantepenaeus paulensis, its sub-cellular localization and transcriptional changes after infection by fungi. The molecular mass of the a2M was estimated at 389 kDa by gel filtration and 197 kDa by SDS-PAGE, under reducing conditions, suggesting that a2M from F. paulensis consists of two identical sub-units, covalently linked by disulphide bonds. The N-terminal amin ...201121888978
a novel antifungal protein from seeds of sesbania virgata (cav.) pers. (leguminosae-faboideae).a novel antifungal protein with a molecular mass around 50 kda was purified from seeds of sesbania virgata (cav.) pers. using ammonium sulfate fractionation followed by gel filtration on a sephadex g-75 superfine (sigma) column and reverse-phase high performance liquid chromatography on a c8 column. the protein, designated fp1-a, with a novel n-terminal sequence amvhspgg(s)fs(p), showed growth inhibitory activity of filamentous fungi aspergillus niger, cladosporium cladosporioides, colletotrichu ...201121881792
evaluation of luminex xtag fungal analyte-specific reagents for rapid identification of clinically relevant fungi.invasive fungal infections (ifi) remain a serious threat to immunocompromised hosts. current diagnostic methods, including fungal culture and antigen detection, are slow and often lack specificity. rapid diagnostic tools with increased sensitivity and specificity could improve the care of patients with ifi. recently, luminex molecular diagnostics (toronto, canada) developed 23 analyte-specific reagents (asrs) for the detection of the most common clinically relevant fungi. this study's objective ...201121880976
mycotic corneal ulcers in upper assam.purpose : to study the association of various risk factors and epidemiological variables of mycotic keratitis treated at a tertiary referral hospital of upper assam. materials and methods: in this hospital-based prospective study a total of 310 consecutive corneal ulcer cases attending the ophthalmology outpatient department of assam medical college were enrolled between april 2007 and march 2009. after clinical and slit-lamp biomicroscopic examination in all suspected cases, smears and culture ...201121836342
novel microbial transformation of resibufogenin by fusarium solani.in this paper, microbial transformation of resibufogenin by fusarium solani as 3.1829 was investigated, and five transformed products were isolated and identified as 3-ketone-resibufogenin (2), 3-one-cyclic 3-(1,2-dimethyl-1,2-ethanediylacetal)-resibufogenin (3), 3-dimethoxyl-resibufogenin (4), 3-epi-resibufogenin (5), and 3-epi-15+¦-hydroxy-7+¦h-bufalin (6), respectively. among them, 3, 4, and 6 are new compounds, and the rare double oxidization of c-3 was reported. in addition, the cytotoxicit ...201121830888
expression of innate and adaptive immune mediators in human corneal tissue infected with aspergillus or fusarium.background.ôçâfilamentous fungi of the genera aspergillus and fusarium are major causes of corneal ulcers in the united states and in the developing world and result in significant visual impairment and blindness. methods.ôçârna was extracted from 110 patients with corneal ulcers in southern india within 1 week of infection with either fusarium solani or aspergillus flavus, and gene expression was determined by quantitative polymerase chain reaction. posttransplant corneas from later stage disea ...201121828275
in vitro antifungal activity of e1210, a novel antifungal, against clinically important yeasts and moulds.e1210 is a new antifungal compound with a novel mechanism of action and broad-spectrum of antifungal activity. we investigated the in vitro antifungal activity of e1210 compared to that of fluconazole, itraconazole, voriconazole, amphotericin b, and micafungin against clinical fungal isolates. e1210 showed potent activity against most candida spp. (mic(90) of ôëñ0.008 to 0.06 ++g/ml) except for candida krusei (mics of 2 to >32 ++g/ml). e1210 showed equally potent activity against fluconazole-res ...201121825291
[mixed infection caused by meloidogyne and pathogenic fungi on siraitia grosvenorii].to study the mixed infection caused by meloidogyne and pathogenic fungi on siraitia grosvenorii,the result can provide basis for controltion.201121818963
fusarium solani: an emerging fungus in chronic diabetic ulcer.fusarium species, a mold which causes disease mainly in plants has emerged as pathogen in immunocompromised patients. fusarium is known to cause keratitis, onychomycosis, and endophthalmitis. fusarium solani, is the most common isolate from clinical specimen. here is a case, a 65-year-old male with type ii diabetes mellitus since 10 years presented with a large ulcer on the left leg since 8 months following trauma. the fungal culture of the escar of the ulcer isolated a mold, fusarium solani. th ...201021814405
[antagonism of trichoderma spp. to fungi caused root rot of sophora tonkinensis].to study the antagonism of trichoderma spp. to fungi s9(fusarium solani)which caused root rot of sophora tonkinensis and discuss the further develop prospects of microbial biological control in soil-borne diseases on chinese herbal medicines.201121809533
osmotin from calotropis procera latex: new insights into structure and antifungal properties.this study aimed at investigating the structural properties and mechanisms of the antifungal action of cposm, a purified osmotin from calotropis procera latex. fluorescence and cd assays revealed that the cposm structure is highly stable, regardless of ph levels. accordingly, cposm inhibited the spore germination of fusarium solani in all ph ranges tested. the content of the secondary structure of cposm was estimated as follows: a-helix (20%), ß-sheet (33%), turned (19%) and unordered (28%), rms ...201121798235
efficacy of oral e1210, a new broad-spectrum antifungal with a novel mechanism of action, in murine models of candidiasis, aspergillosis, and fusariosis.e1210 is a first-in-class, broad-spectrum antifungal with a novel mechanism of action - inhibition of fungal glycosylphosphatidylinositol biosynthesis. in this study, the efficacies of e1210 and reference antifungals were evaluated in murine models of oropharyngeal and disseminated candidiasis, pulmonary aspergillosis, and disseminated fusariosis. oral e1210 demonstrated dose dependent efficacy in these infections caused by candida species, aspergillus spp. and fusarium solani. in the treatment ...201121788462
fusarium soloni mycetoma.a young apparently healthy, non-diabetic, hiv non-reactive woman presented with a mycetoma-like lesion on right buttock. discharge was scanty, and mycotic grains were not seen. biopsy of sinus track was obtained for microscopy and culture. microscopic examination revealed plenty of fungal hyphae in direct microscopic examination of grounded tissues in saline; koh, gram's, and h and e-stained smears. all the three inoculated slants of sabouraud's media yielded heavy growth of fusarium solani. pre ...201121772597
amphotericin b and voriconazole susceptibility profiles for the fusarium solani species complex: comparison between the e-test and clsi m38-a2 microdilution methodology. 201121744037
antibacterial effects of enniatins j(1) and j(3) on pathogenic and lactic acid bacteria.enniatins (ens) are n-methylated cyclohexadepsipeptides, secondary metabolites produced by various species of the genus fusarium. they are known to act as antifungal, antiyeast and antibacterial and to possess antiinsecticidal and phytotoxic properties. in this study we evaluated for the first time the antibiotic effect of pure fractions of en j(1) and j(3) on several pathogenic strains and lactic acid bacteria. the ens j(1) and j(3) were purified from the fermentation extract of fusarium solani ...201121742008
epidemiological and clinico-mycological profile of fungal wound infection from largest burn centre in asia.the current study was conducted to know the incidence, predisposing factors, spectrum, clinical profile and antifungal susceptibility (afs) of fungal wound infection (fwi) in burn patients. of a total of 71 patients, 20 (28.2%) emerged with the diagnosis of fwi. fungal pathogens in this study were candida tropicalis (14%), candida parapsilosis (5.6%), aspergillus niger (2.8%) and one each of candida albicans (1.4%), candida glabrata (1.4%), syncephalestrum (1.4%) and fusarium solani (1.4%). all ...201121740469
kinetics and mechanism of the cutinase-catalyzed transesterification of oils in aot reversed micellar system.the kinetics of the enzymatic transesterification between a mixture of triglycerides (oils) and methanol for biodiesel production in a bis(2-ethylhexyl) sodium sulfosuccinate (aot)/isooctane reversed micellar system, using recombinant cutinase from fusarium solani pisi as a catalyst, was investigated. in order to describe the results that were obtained, a mechanistic scheme was proposed, based on the literature and on the experimental data. this scheme includes the following reaction steps: the ...201121739170
identification and comparison of cutinases for synthetic polyester degradation.cutinases have been exploited for a broad range of reactions, from hydrolysis of soluble and insoluble esters to polymer synthesis. to further expand the biotechnological applications of cutinases for synthetic polyester degradation, we perform a comparative activity and stability analysis of five cutinases from alternaria brassicicola (abc), aspergillus fumigatus (afc), aspergillus oryzae (aoc), humicola insolens (hic), and the well-characterized fusarium solani (fsc). of the cutinases, hic dem ...201121713515
new species from the fusarium solani species complex derived from perithecia and soil in the old world tropics.abstract: a large collection of strains belonging to the fusarium solani species complex (fssc) was isolated from soil and perithecia in primary forests in sri lanka (from fallen tree bark) and tropical australia (queensland, from fallen tree fruits and nuts). portions of the translation elongation factor 1-alpha (tef1) gene, the nuclear large subunit (nlsu), and internal transcribed spacer regions (its) of the nuclear ribosomal rna genes were sequenced in 52 isolates from soil and perithecia. t ...201121700636
the synthetic strigolactone gr24 influences the growth pattern of phytopathogenic fungi.strigolactones that are released by plant roots to the rhizosphere are involved in both plant symbiosis with arbuscular mycorrhizal fungi and in plant infection by root parasitic plants. in this paper, we describe the response of various phytopathogenic fungi to the synthetic strigolactone gr24. when gr24 was embedded in the growth medium, it inhibited the growth of the root pathogens fusarium oxysporum f. sp. melonis, fusarium solani f. sp. mango, sclerotinia sclerotiorum and macrophomina phase ...201121688170
synthesis, characterization and biological properties of thienyl derived triazole schiff bases and their oxovanadium(iv) complexes.a new series of biologically active thienyl derived triazole schiff bases and their oxovanadium(iv) complexes have been synthesized and characterized on the basis of physical (m.p., magnetic susceptibility and conductivity), spectral (ir, (1)h and (13)c nmr, electronic and mass spectrometry) and microanalytical data. all the schiff base ligands and their oxovanadium(iv) complexes have been subjected to in vitro antibacterial activity against four gram-negative (escherichia coli, shigella flexner ...201121635212
an outbreak of fusarium solani endophthalmitis after cataract surgery in an eye training and research hospital in istanbul.to report an outbreak of fusarium solani endophthalmitis after uneventful cataract surgeries performed on the same day in the same operating room. nine patients underwent phacoemulsification at 4th clinic of beyoglu eye training and research hospital in istanbul. cefuroxime axetyl was injected intracamerally from the same vial to all patients at the end of surgery. all patients developed acute postoperative endophthalmitis. presentation, cultural studies, treatment, clinical responses and risk f ...201121627695
importance of rub and rinse in use of multipurpose contact lens solution.purpose.: the introduction of contact lens multipurpose disinfection solution (mpds) that can be used in conjunction with a "no-rub" regimen has simplified lens care requirements. once adhered to a surface, microorganisms can become less susceptible to disinfection. the aim of the study was to evaluate the effect of various regimen steps on the efficacy of mpds when used with silicone hydrogel and conventional lenses. methods.: commercially available mpdss containing polyquad or polyhexamethylen ...201121623253
olecranon bursa with fusarium solani infection in an otherwise healthy patient. 201121605189
antifungal properties of wheat histones (h1-h4) and purified wheat histone h1.wheat ( triticum spp.) histones h1, h2, h3, and h4 were extracted, and h1 was further purified. the effect of these histones on specific fungi that may or may not be pathogenic to wheat was determined. these fungi included aspergillus flavus , aspergillus fumigatus , aspergillus niger , fusarium oxysporum , fusarium verticillioides , fusarium solani , fusarium graminearum , penicillium digitatum , penicillium italicum , and greeneria uvicola . non-germinated and germinating conidia of these fung ...201121595494
synthesis, characterization and biological studies of sulfonamide schiff's bases and some of their metal derivatives.a new series of schiff base ligands derived from sulfonamide and their metal(ii) complexes [cobalt(ii), copper(ii), nickel(ii) and zinc(ii)] have been synthesized and characterized. the nature of bonding and structure of all the synthesized compounds has been explored by physical, analytical and spectral data of the ligands and their metal(ii) complexes. the authors suggest that all the prepared complexes possess an octahedral geometry. the ligands and metal(ii) complexes have been screened for ...201121534864
antifungal activity of rhizospheric bacteria.fluorescent pseudomonad spp. were isolated from the rhizosphere of potato plants (algeria) by serial dilutions of rhizosphere soils on kings b medium and were tested for their antifungal activity. the antifungal activity of the pseudomonas isolated from potatoes rhizosphere was tested against pythium ultimum, rhizoctonia solani and fusarium oxysporum in dual culture with bacteria on pda. the petri dish was divided into tow, on one the bacteria was spread and on the opposite side fungal plugs wer ...201021534477
characterization of rhizosphere bacteria for control of phytopathogenic fungi of tomato.fluorescent pseudomonas spp., isolated from rhizosphere soil of tomato and pepper plants, were evaluated in vitro as potential antagonists of fungal pathogens. strains were characterized using the api 20ne biochemical system, and tested against the causal agents of stem canker and leaf blight (alternaria alternata f. sp. lycopersici), southern blight (sclerotium rolfsii sacc.), and root rot (fusarium solani). to this end, dual culture antagonism assays were carried out on 25% tryptic soy agar, k ...201121507555
in vitro efficacy of a povidone-iodine 0.4% and dexamethasone 0.1% suspension against ocular pathogens.to assess the efficacy of a povidone-iodine 0.4%-dexamethasone 0.1% suspension against bacterial, fungal, and acanthamoeba clinical isolates.201121420603
elimination of hydrophobic volatile organic compounds in fungal biofilters: reducing start-up time using different carbon sources.fungal biofilters have been recently studied as an alternative to the bacterial systems for the elimination of hydrophobic volatile organic compounds (voc). fungi foster reduced transport limitation of hydrophobic vocs due to their hydrophobic surface and extended gas exchange area associated to the hyphal growth. nevertheless, one of their principal drawbacks is their slow growth, which is critical in the start-up of fungal biofilters. this work compares the use of different carbon sources (gly ...201021404250
activation of focal adhesion kinase enhances the adhesion of fusarium solani to human corneal epithelial cells via the tyrosine-specific protein kinase signaling pathway.to determine the role of the integrin-fak signaling pathway triggered by the adherence of f. solani to human corneal epithelial cells (hcecs).201121403855
effect of bromine oxidation on high-performance thin-layer chromatography multi-enzyme inhibition assay detection of organophosphates and carbamate insecticides.following high-performance thin-layer chromatography, thiophosphate pesticides, which inhibit choline esterases, are detectable using a multi-enzyme inhibition assay (hptlc-ei) based on rabbit liver esterase (rle), bacillus subtilis (bs2) esterase, or cutinase (from fusarium solani pisi). because choline esterase inhibition is more effective after conversion of thiophosphate thions into their corresponding oxons, a pre-oxidation step was added to the hptlc-ei assay. bromine vapour was found to b ...201121397236
antimicrobial efficacy of multi-purpose contact lens disinfectant solutions following evaporation.non-compliance is a significant factor in contact lens related microbial keratitis and includes solution reuse and failure to recap the lens storage case resulting in evaporation effects. to address this, impact of partial evaporation on the antimicrobial efficacy of multipurpose contact lens care solutions was investigated.201121393050
accurate and practical identification of 20 fusarium species by seven-locus sequence analysis and reverse line blot hybridization, and an in vitro antifungal susceptibility study.eleven reference and 25 clinical isolates of fusarium were subject to multilocus dna sequence analysis to determine the species and haplotypes of the fusarial isolates from beijing and shandong, china. seven loci were analyzed: the translation elongation factor 1 alpha gene (ef-1+¦); the nuclear rrna internal transcribed spacer (its), large subunit (lsu), and intergenic spacer (igs) regions; the second largest subunit of the rna polymerase gene (rpb2); the calmodulin gene (cam); and the mitochon ...201121389150
[mycetoma caused by fusarium solani]. 201121367408
[identification of pathogens causing root rot of sophora tonkinensis].to identify the pathogens what caused of root rot, it can provide method of theoretical gist of integrated pest management of these kinds of diseases in the future.201021355186
effect of artificial reconstitution of the interaction between the plant camptotheca acuminata and the fungal endophyte fusarium solani on camptothecin biosynthesis.fungal endophytes inhabit healthy tissues of all terrestrial plant taxa studied and occasionally produce host-specific compounds. we recently isolated an endophytic fungus, fusarium solani, from camptotheca acuminata, capable of biosynthesizing camptothecin (cpt, 1), but this capability substantially decreased on repeated subculturing. the endophyte with an impaired 1 biosynthetic capability was artificially inoculated into the living host plants and then recovered after colonization. although t ...201121348469
[clinical and mycological evaluation of onychomycosis among brazilian hiv/aids patients].onychomycosis is common in immunocompromised patients, but emerging species have been verified, thereby modifying the epidemiological profile of this mycosis. thus, the aim of this study was to evaluate clinical and mycological profile of onychomycosis among hiv/aids patients.201121340406
glyceollin, a soybean phytoalexin with medicinal properties.this review covers the biosynthesis of glyceollin and its biological activities including antiproliferative/antitumor action (toward b16 melanoma cells, lncap prostate cancer cells, and bg-1 ovarian cancer cells), anti-estrogenic action (through estrogen receptors a- and ß-), antibacterial action (toward erwinia carotovora, escherichia coli, bradyrhizobium japonicum, sinorhizobium fredii ), antinematode activity, and antifungal activity (toward fusarium solani, phakospora pachyrhizi, diaporthe p ...201121336922
osmotin purified from the latex of calotropis procera: biochemical characterization, biological activity and role in plant defense.a protein, similar to osmotin- and thaumatin-like proteins, was purified from calotropis procera (ait.) r.br latex. the isolation procedure required two cation exchange chromatography steps on 50mm na-acetate buffer (ph 5.0) cm-sepharose fast flow and 25 mm na-phosphate buffer (ph 6.0) resource-s, respectively. the protein purity was confirmed by an unique n-terminal sequence [atftirnncpytiwaaavpgggrrlnsggtwtinvapgta]. the osmotin (cposm) appeared as a single band (20,100 da) in sodium dodecyl s ...201121334906
simultaneous detection and identification of aspergillus and mucorales species in tissues collected from patients with fungal rhinosinusitis.rapid detection and differentiation of aspergillus and mucorales species in fungal rhinosinusitis diagnosis are desirable, since the clinical management and prognosis associated with the two taxa are fundamentally different. we describe an assay based on a combination of broad-range pcr amplification and reverse line blot hybridization (pcr/rlb) to detect and differentiate the pathogens causing fungal rhinosinusitis, which include five aspergillus species (a. fumigatus, a. flavus, a. niger, a. t ...201121325541
endophthalmitis as primary clinical manifestation of fatal fusariosis in an allogeneic stem cell recipient.the occurrence of infections due to previously rare opportunistic pathogens is increasing despite the use of novel treatment strategies for immunocompromised patients. here, we report the case of a patient presenting with fever, muscle pain, and bilateral endophthalmitis after allogeneic hematopoietic stem cell transplantation. fusarium solani was isolated from peripheral blood samples and identified as the cause of gradual bilateral vision loss, despite appropriate antifungal prophylaxis, and t ...201121324055
evaluations of shorter exposures of contact lens cleaning solutions against fusarium oxysporum species complex and fusarium solani species complex to simulate inappropriate usage.an outbreak of fusarium keratitis in contact lens users resulted in withdrawal of renu with moistureloc solution, although the exact cause of the outbreak remains enigmatic. we evaluated current and discontinued multipurpose cleaning solutions (mpss; moistureloc, equate, multiplus, and optifree express) against plankton- and biofilm-derived cells of fusarium oxysporum species complex (fosc) and f. solani species complex (fssc). the methods included a traditional assay based on cfu counts and a n ...201121300826
performance of a cutinase membrane reactor for the production of biodiesel in organic media.the enzymatic transesterification of oils with an alcohol, using recombinant cutinase of fusarium solani pisi microencapsulated in sodium bis(2-ethylhexyl) sulfosuccinate (aot)/isooctane reversed micelles, was performed in a membrane bioreactor (mbr). a tubular ceramic membrane with a nominal molecular weight cut off of 15,000 da was used to retain the enzyme, and characterized in terms of rejection coefficients of the reaction components by transmission experiments. the performance of the mbr i ...201121290382
pathogenic spectrum of fungal keratitis and specific identification of fusarium solani.to investigate the predominant causative pathogens and epidemiologic features of fungal keratitis and establish a rapid, specific molecular method to detect fungal keratitis caused by fusarium solani.201121273551
Refresh
firstprev
12345678910...
nextlast
Displaying items 401 - 500 of 1378