Publications
| Title | Abstract | Year Filter | PMID(sorted descending) Filter |
|---|
| retention and attempted mechanical transmission of ehrlichia risticii by stomoxys calcitrans. | the ability of adult stomoxys calcitrans (l.) (diptera: muscidae) to retain viable ehrlichia risticii (rickettsiaceae), the aetiologic agent of potomac horse fever (phf), and mechanically transmit the pathogen from citrated bovine blood artificially infected with e. risticii to susceptible mice was studied. viable e. risticii were found in the digestive tract of s. calcitrans 3 h after the flies had engorged to repletion on infected blood; however, no e. risticii were detected in flies > or = 2 ... | 1994 | 8161843 |
| inundative releases of pteromalid parasitoids (hymenoptera: pteromalidae) for the control of stable flies, stomoxys calcitrans (l.) (diptera: muscidae) at confined cattle installations in west central nebraska. | fly pupal parasitoids, primarily muscidifurax raptor girault and sanders and spalangia nigroaenea curtis, purchased from commercial insectaries, failed to reduce numbers of stable fly, stomoxys calcitrans (l.), significantly despite weekly releases of high numbers at one feedlot and one dairy during 1990 and a different feedlot and dairy in 1991. parasitoid emergence from stable fly puparia were not significantly greater in the confinements where releases were made compared with confinements whe ... | 1994 | 8027475 |
| vector control by removal trapping. | the classic approach to vector control where large tracts of land are treated with an insecticide has many shortcomings. these include high cost, chemical resistance of target species to many of the widely used insecticides, a lack of public acceptance, and the detrimental effect of sprays on nontarget species. removal trapping, the use of visual, auditory, and olfactory attractants to lure target species into small areas where they are killed, has recently received well-deserved attention as a ... | 1994 | 8024078 |
| isolation and characterization of a diuretic peptide common to the house fly and stable fly. | an identical crf-related diuretic peptide (musca-dp) was isolated and characterized from whole-body extracts of the house fly, musca domestica, and stable fly, stomoxys calcitrans. the peptide stimulates cyclic amp production in manduca sexta malpighian tubules and increases the rate of fluid secretion by isolated musca domestica tubules. the 44-residue peptide, with a mol.wt. of 5180, is amidated, and has the primary structure: nkpslsivnpldvlrqrllleiarrqmkentrqvelnrailknv-nh2. musca-dp has a hi ... | 1994 | 7991460 |
| overwintering of the stable fly (diptera: muscidae) in southeastern nebraska. | adult stable flies, stomoxys calcitrans (l.), were monitored during three winters at two, four, and 13 locations with alsynite fiberglass traps and by examination of the interiors of buildings. no stable flies were found inside buildings during the winter. adult stable flies were consistently caught on alsynite traps at one location during two winters and at two other locations during one winter. distribution and physiological age of these flies indicate that they emerged from pupae that had dev ... | 1994 | 7836614 |
| the ability of stomoxys calcitrans and mechanical means to transmit trypanosoma (brucei) evansi from goats to camels in kenya. | 1994 | 7831761 | |
| [the absolute count of the housefly (musca domestica) and the stable fly (stomoxys calcitrans) in buildings for cattle]. | the direct correlative dependence between indices of absolute and relative number of two fly species calculated by peterson's method is shown. the way of calculation of the absolute number of m. domestica and s. calcitrans and the receipt of the selection from subpopulations, which take in account peculiarities of adult fly distribution in different technological regimes of cattle keeping, peculiarities of daily activity and influence of temperature-photo factors on imago, are proposed. the atte ... | 1994 | 7816502 |
| biology and control of tabanids, stable flies and horn flies. | tabanids are among the most free-living adult flies which play a role as livestock pests. a single blood meal is used as a source of energy for egg production (100-1,000 eggs per meal), and females of certain species can oviposit before a blood meal is obtained (autogeny). therefore, the maintenance of annual populations requires successful oviposition by only 2% of females. wild animal blood sources are usually available to maintain annual tabanid populations. larval habitats are also independe ... | 1994 | 7711307 |
| temperature and population density effects on feeding activity of stomoxys calcitrans (diptera: muscidae) on cattle. | the relationship of population density and temperature to feeding activity of stable flies, stomoxys calcitrans (l.), on cattle was studied by placing cattle in constant temperature chambers with controlled fly density and temperature. the number of flies per front leg declined within hours after release but increased with fly density and temperature. the time flies spent on the host during a 5.5-h exposure period ranged from < 2.5 min at temperature < 16 degrees c to > 34 min when temperature w ... | 1995 | 7650712 |
| structural characterization of muscles and epithelial sheaths of the oviduct of stomoxys calcitrans (diptera: muscidae). | fine structure of both muscle and epithelial cells in the oviduct of stomoxys calcitrans (l.) was characterized. each tubular section of the oviduct consisted of an inner epithelial sheath enveloped by an outer network of muscle fibers that showed noticeable variation in cross-sectional thickness. some regions consisted of a single cellular layer, whereas others were composed of two or more layers of cells. moreover, a wide variation in muscle fiber orientation was observed, with some cells appe ... | 1995 | 7616524 |
| exposure to stable flies reduces spatial learning in mice: involvement of endogenous opioid systems. | biting flies influence both the physiology and behaviour of domestic and wild animals. this study demonstrates that relatively brief (60 min) exposure to stable flies, stomoxys calcitrans (l.), affects the spatial abilities of male mice. stable fly exposure resulted in poorer subsequent performance in a water maze task in which individual mice had to learn the spatial location of a submerged hidden platform using extramaze visual cues. determinations of spatial acquisition and retention were mad ... | 1995 | 7548949 |
| the temperature preferences of the motile stages of stomoxys calcitrans linnaeus (diptera: muscidae). | when adult stomoxys calcitrans were exposed to a temperature gradient, 66% of them selected temperatures between 20, 1 and 32, 5 degrees c. the larval stages preferred temperatures between 19, 5 and 33, 2 degrees c. although the differences in the temperature preferences of the different larval stages were not significant, the fully-fed larvae appear to prefer slightly cooler conditions than the feeding stages. the temperature preferences of both the adults and the larvae are not influenced by t ... | 1980 | 7454236 |
| field trials to assess the efficacy of permethrin for the control of flies on cattle. | permethrin [3-phenoxybenzyl (+/-) cis, trans--2,2dimethyl-3-(2,2-dichlorovinyl) cyclopropane-1-carboxylate], a new synthetic pyrethroid, was applied to cattle on farms in the united kingdom to assess its efficacy in fly control under field conditions. when 250 ml 0.1 per cent permethrin was applied to the backs of cattle using a knapsack sprayer, adequate control of horn flies, haematobia irritans, was achieved for over three weeks. application of 500 ml 0.1 per cent all over each animal gave on ... | 1980 | 7445329 |
| a field trial to determine the effect of fly control using permethrin on milk yields in dairy cattle in the uk. | permethrin, applied by knapsack sprayer or spray arch, was used to control flies on cattle in two dairy herds in the united kingdom. the spray washes were applied at nominal rates of 0.5 litre of 0.1 per cent permethrin per animal and 1.0 litre of 0.05 per cent permethrin per animal respectively. the individual milk yields of two groups of cows were recorded before and after treatment. in both cases there was a significant increase in milk yield after treatment. the mean yield per cow per day du ... | 1980 | 7445328 |
| physiological age determination in female stomoxys calcitrans linnaeus (diptera: muscidae). | the primary sex organs of female stomoxys calcitrans consist of a single pair of ovaries, each containing 80-100 polytrophic ovarioles. a natural population of these females can be grouped according to age into different reproductive categories. the technique described below defines these categories and enables one to distinguish between newly-emerged, nulliparous and uniparous females and females that have reproduced twice (biparous) or more (pauciparous). | 1980 | 7413165 |
| control of the stable fly, stomoxys calcitrans (diptera: muscidae), on st. croix, u.s. virgin islands, using integrated pest management measures. iii. field techniques and population control. | 1981 | 7328607 | |
| control of the stable fly, stomoxys calcitrans (diptera: muscidae), on st. croix, u.s. virgin islands, using integrated pest management measures. ii. mass rearing and sterilization. | 1981 | 7328606 | |
| control of the stable fly, stomoxys calcitrans (diptera: muscidae), on st. croix, u.s. virgin islands, using integrated pest management measures. i. feasibility of sterile male releases. | 1981 | 7328605 | |
| attempts to transmit anaplasma marginale with hippobosca rufipes and stomoxys calcitrans. | three attempts to transmit anaplasmosis with field collections of hippobosca rufipes were unsuccessful, despite the fact that the flies had been fed initially on splenectomized cattle acutely infected with anaplasma marginale. however, 1 out of the 3 attempts, made concurrently with the others, to transmit this organism with stomoxys calcitrans was successful. the prepatent period was 27 days. | 1981 | 7312304 |
| [horn fly (muscidae) fauna and ecology in the area of the baikal-amur mainline]. | 4 species of horn flies were recorded from the territory of the baikal-amur railway: stomoxys calcitrans, haematobia stimulans, lyperosia irritans and lyperosia titillans. the autumn horn fly was found to be most widespread and dangerous. it was especially abundant in priamurje, in the zone of the monsoon climate, where it behaves as a typical pasture species. the behaviour, daily and seasonal dynamics and flight duration (90 to 150 days) of horn flies changes noticeably depending on natural con ... | 1981 | 7279439 |
| reciprocal translocations and partial correlation of chromosomes in the stable fly. | an initial investigation of the genetics of the stable fly, stomoxys calcitrans (l.), is described. two recessive, autosomal mutants, carmine eye (ca) and rolled down wing (rd), were assigned to chromosomes 2 and 4, respectively. sex is apparently determined by a locus on chromosome 1. crossing over is restricted to females. six reciprocal translocations were induced with gamma radiation and used to assign ca and rd to their respective chromosomes. | 1981 | 7276509 |
| flies associated with cattle in south west scotland during the summer months. | the sheep headfly, hydrotaea irritans, and morellia simplex were the species most frequently associated with cattle at pasture and comprised 69.01 per cent and 13.93 per cent, respectively, of the total fly collection made from grazing cattle. the most prevalent biting fly was haematobosca stimulans which comprised 4.46 per cent of the total catch. a few clegs, haematopota pluvialis, and horse flies, hybomitra distinguenda, were also recorded. a few of the headflies swarming around cattle entere ... | 1981 | 7244374 |
| purification and characterization of chitinase from the stable fly, stomoxys calcitrans. | 1982 | 7103511 | |
| epidemiological and immunological studies of sweet itch in horses in israel. | a survey of sweet itch in horses in israel based on a questionnaire to owners reported that 158 of 723 horses (21.8 per cent) had sweet itch lesions. the results indicated that the likelihood of a horse acquiring sweet itch decreased with increasing altitude but no definite association with rainfall zones was evident. variation in the density of the horse population, however, obscured these observations. in the population surveyed, stallions were more sensitive than mares and pale horses appeare ... | 1983 | 6879963 |
| comparative study of hemocytes and associated cells of some medically important dipterans. | the aim of this work is to study, characterize, and compare different morphological types of hemocytes of glossina austeni, g. morsitans, calliphora erythrocephala, stomoxys calcitrans, lucilia sericata, aedes aegypti, and culex quinquefasciatus. this information is intended to provide a basis for future studies of the cellular defense mechanisms of these dipterans. seven morphological types of hemocytes were identified by phase-contrast optics: prohemocytes, plasmatocytes, thrombocytoids, granu ... | 1982 | 6764649 |
| effect of fluorescent dust color on the attractiveness of attractant self-marking devices to the stable fly (diptera: muscidae). | 1984 | 6725745 | |
| mechanical transmission of equine infectious anemia virus by deer flies (chrysops flavidus) and stable flies (stomoxys calcitrans). | 1983 | 6297339 | |
| incorporation of [u-14c] palmitate into lipids by the stable fly, stomoxys calcitrans (l.). | the incorporation in vivo of [u-14c] palmitate into fat body lipids was studied in the blood feeding stable fly, stomoxys calcitrans. palmitate was rapidly esterified into triacylglycerol and after one-half h, nearly one third of the total recovered label was in the triacylglycerol fraction with a concomitant loss of radioactivity in the free fatty acids. the fat body, from one day sugar-water-fed flies incorporated more label into triacylglycerol than those from flies fed on blood. the present ... | 1982 | 6182855 |
| synergistic effect of two stimulants to induce probing in stomoxys calcitrans (l.). | 1967 | 6074947 | |
| fine structure of the tip of chemosensitive hairs in two blow flies and the stable fly. | 1967 | 6062911 | |
| [possibilities of using polychlorpinene for control of house flies (musca domestica l.) and stomoxys calcitrans l. in cattle-breeding farms]. | 1966 | 6012364 | |
| transmission of dermatophilus congolensis by stomoxys calcitrans and musca domestica. | 1966 | 5959398 | |
| electron microscopy of the contact chemoreceptors of the stable fly, stomoxys calcitrans (diptera: muscidae). | 1965 | 5836876 | |
| use of who tsetse fly kit for determining resistance in the stable fly. | 1965 | 5826353 | |
| activity of parasites from diptera: musca domestica, stomoxys calcitrans, and species of fannia, muscina, and ophyra. ii. at sites in the eastern hemisphere and pacific area. | 1968 | 5758059 | |
| color vision of the female stable fly, stomoxys calcitrans. | 1968 | 5655801 | |
| non-cyclical transmission of trypanosomiasis in uganda. ii. experimental assessment of the survival time of trypanosoma brucei in stomoxys calcitrans. | 1971 | 5568557 | |
| biological evaluation of juvenile hormone compounds against pupae of the stable fly. | 1971 | 5546156 | |
| repellents for stomoxys calcitrans (l.), the stable fly: techniques and a comparative laboratory assessment of butyl methylcinchoninate. | 1970 | 5450437 | |
| interactions between stimuli in the induction of probing by stomoxys calcitrans. | 1970 | 5449734 | |
| cytology of gamma-irradiated gonads of stomoxys calcitrans (diptera: muscidae). | 1970 | 5440495 | |
| hormones for control of livestock arthropods. development of an assay to select candidate compounds with juvenile hormone activity in the stable fly. | 1970 | 5431682 | |
| precipitin test identification of blood meals of stomoxys calcitrans (l.) caught on california poultry ranches, and observations of digestion rates of bovine and citrated human blood. | 1970 | 5425687 | |
| the probing response of stomoxys calcitrans to certain physical and olfactory stimuli. | 1970 | 5417708 | |
| [development of the causative agent of deer setariasis in the organism of the stable fly (haematobia simulans)]. | 1971 | 5166338 | |
| aerial ulv and lv applications of insecticides for control of the stable fly and the horn fly. | 1971 | 5122334 | |
| ovarian maturation in stable flies: inhibition by 20-hydroxyecdysone. | the steroid 20-hydroxyeedysone when given by mouth inhibits ovarian maturation in the stable fly, stomoxys calcitrans (l.). by preventing lipid synthesis flecessary foir vitellogenlesis in the developing oocyte. | 1971 | 5103544 |
| laboratory evaluation of compounds to determine juvenile hormone activity against the stable fly. | 1972 | 5085792 | |
| utilization of injected glucose by the tsetse fly (glossina) and the stable fly (stomoxys). | 1972 | 5009196 | |
| insect growth regulators: large plot field tests against the stable fly in cattle feedlots. | 1974 | 4839230 | |
| juvenile hormone activity of substituted aryl 3,7-dimethyl-6-octenyl ethers in the stable fly and house fly. | 1974 | 4815643 | |
| [experiences with dimethoate drugs in stable fly control]. | 1973 | 4790809 | |
| sticky traps for sampling population of stomoxys calcitrans. | 1973 | 4770949 | |
| responses of the house fly, stable fly, and face fly to electromagnetic radiant energy. | 1973 | 4770946 | |
| juvenile hormone activity of citronellylamine and citronellol derivatives against pupae of the stable fly and the house fly (diptera: muscidae). | 1973 | 4760623 | |
| persistence and leaching of juvenile hormone analogs in stable fly laboratory rearing medium. | 1973 | 4755820 | |
| glycogen phosphorylase activity in pharate adults of the stable fly and the effects of a juvenile hormone analogue. | 1973 | 4731650 | |
| determination of the juvenile hormone-active compound altosid and its stability in stable fly medium. | 1973 | 4710947 | |
| cutaneous lesions on cattle caused by stable fly. | 1972 | 4664371 | |
| a new approach in integrated control: insect juvenile hormone plus a hymenopteran parasite against the stable fly. | two insect juvenile hormone analogs, 4[(6,7-epoxy-3-ethyl-7-methyl-2-nonenyl)oxy] benzene and 6,7-epoxy-1-(p-ethylphenoxy)-3,7-dimethyl-2-octene, when applied topically to pupae of the stable fly, stomoxys calcitrans (l.), were morphogenetically effective against the metamorphosing pupae but did not affect oviposition and development of the hymenopteran parasite, muscidifurax raptor girault and sanders, in the treated pupae. also, reproductivity of the parent generation of parasites was not affe ... | 1972 | 4640067 |
| juvenilizing activity of compounds related to the juvenile hormone against pupae of the stable fly. | 1972 | 4639458 | |
| insect growth regulators: laboratory and field evaluations of thompson-hayward th-6040 against the house fly and the stable fly. | 1974 | 4443468 | |
| a laboratory technique for studying the mechanical transmission of bovine herpes mammillitis virus by the stable fly (stomoxys calcitrans l.). | 1973 | 4375833 | |
| role of horse fly (tabanus fuscicostatus hine) and stable fly (stomoxys calcitrans l.) in transmission of equine infectious anemia to ponies in louisiana. | 1973 | 4357708 | |
| dispersal of adult stomoxys calcitrans (l.) (diptera: muscidae) from known immature developmental areas. | 1985 | 4008745 | |
| systemic activity of a benzimidazoline compound in cattle against ticks and biting flies. | a benzimidazoline compound [4-nitro-2-(1,1,2,2-tetrafluoroethyl)-6 -(trifluoromethyl)-1h-benzimidazol-2-, 01, sodium salt] referred to as el-979 showed systemic acaricidal and insecticidal activity in cattle against 2 tick species, amblyomma maculatum (gulf coast tick) and dermacentor variabilis (american dog tick) and adult stomoxys calcitrans (stable flies). larvae of black blow fly (phormia regina) were fed serum collected from treated calves. a complete kill of larvae was obtained with a ser ... | 1985 | 4002603 |
| cross-reaction of tick salivary antigens in the boophilus microplus-cattle system. | calves were immunized with boophilus microplus saliva, filtered through millipore membranes, in freund's complete adjuvant. serum samples were tested by passive hemagglutination against babesia bigemina, anaplasma marginale, b. microplus larvae extract, stomoxys calcitrans extract and b. microplus saliva. after immunization, titers to saliva, larval tick-extract and to s. calcitrans were increased. the challenge with live tick larvae enhanced the formation of antibodies against larva extract, fl ... | 1985 | 3992881 |
| [ultrafine structure of the malpighian tubules of hematophagous diptera]. | the ultrastructure of malpighian tubes of 5 species of bloodsucking diptera was studied: culicoides pulicaris, tabanus bromius, hybomitra schineri, haematopota pluvialis and stomoxys calcitrans. the malpighian tubes of the above species include the cells of two types. the most abundant cells of the 1st type contain many spherical inclusions which represent deposits of mineral compounds. the microvilli of the 1st type cells always contain mitochondria. cells of the 2nd type are characterized by a ... | 1985 | 3975070 |
| mechanical transmission of rift valley fever virus by hematophagous diptera. | experimental studies were conducted to determine if hematophagous diptera were capable of mechanical transmission of rift valley fever (rvf) virus to laboratory animals. all species tested (glossina morsitans, aedes aegypti, aedes taeniorhynchus, culex pipiens, stomoxys calcitrans, lutzomyia longipalpis, and culicoides variipennis) mechanically transmitted the virus to hamsters. mechanical transmission rates for g. morsitans ranged from 0-100%, with the probability of mechanical transmission pos ... | 1985 | 3970308 |
| systemic activity of closantel for control of lone star ticks, amblyomma americanum (l.), on cattle. | cattle were treated once at 5 mg/kg orally or subcutaneously or daily at 0.1-5 mg/kg orally or 0.1-1 mg/kg subcutaneously with closantel, n-[5-chloro-4-[(4-chlorophenyl)cyanomethyl]-2-methylphenyl]-2-hydroxy-3, 5-diiodobenzamide, and numbers and weights of engorged females, weights of egg masses and hatch of eggs of lone star ticks, amblyomma americanum, were recorded. effectiveness of treatments on reproduction was determined by comparing total estimated larvae (el) (el = wt. egg mass x est. % ... | 1985 | 3870959 |
| electrophoretic comparisons of isozymes from selected populations of stomoxys calcitrans (diptera: muscidae). | 1987 | 3820240 | |
| use of a genetic technique for separating the sexes of the stable fly (diptera: muscidae). | 1986 | 3771912 | |
| physiological and nutritional response of beef steers to infestations of the stable fly (diptera: muscidae). | 1986 | 3771911 | |
| [a stomoxys calcitrans outbreak on a dairy farm]. | in late summer and autumn of 1982 stomoxys calcitrans disturbed cattle on a dairy farm and scourged the people working there. both actively and passively stomoxys calcitrans got into the cowsheds from its nearby breeding sites on open silos. the successful fly control combined sanitary measures with the application of pyrethrum insecticide aerosol. | 1986 | 3717689 |
| effect on milk production of controlling muscid flies, and reducing fly-avoidance behaviour, by the use of fenvalerate ear tags during the dry period. | fenvalerate ear tags reduced fly loads on dry dairy cattle by 95% between july and september. fly dislodging behaviour, such as ear flicks which correlated with numbers of musca autumnalis on the face and stamps/kicks which correlated with numbers of stomoxys calcitrans on the legs, was also significantly reduced. there was no significant difference between the tagged and untagged groups in the total time spent grazing each day. milk yields were not statistically significantly different, but the ... | 1987 | 3597919 |
| intestinal myiasis in a baby attending a public health clinic. | this article describes a case of intestinal myiasis--the presence of fly larvae in the intestines--in a 12-month-old baby. the asymptomatic child was twice treated by her physician for a presumptive diagnosis of pinworm infection. the mother continued to see "worms" in the child's stool and brought her to a public health primary care clinic where she was evaluated by nurse practitioners. larvae (maggots) of the false stable fly, muscina stabulans, were identified in each of two stool specimens c ... | 1987 | 3587779 |
| physiological and nutritional response of beef steers to combined infestations of horn fly and stable fly (diptera: muscidae). | 1987 | 3571696 | |
| vinyl plastic cage design for single-mating experiments to chemosterilize the stable fly (diptera: muscidae) with bisazir. | 1988 | 3351084 | |
| an improved alsynite trap for stable flies, stomoxys calcitrans (diptera: muscidae). | 1988 | 3193434 | |
| mechanical transmission of bacillus anthracis by stable flies (stomoxys calcitrans) and mosquitoes (aedes aegypti and aedes taeniorhynchus). | we evaluated the potential of stable flies, stomoxys calcitrans, and two species of mosquitoes, aedes aegypti and aedes taeniorhynchus, to transmit bacillus anthracis vollum 1b mechanically. after probing on hartley guinea pigs with a bacteremia of ca. 10(8.6) cfu of b. anthracis per ml of blood, individual or pools of two to four stable flies or mosquitoes were allowed to continue feeding on either uninfected guinea pigs or a/j mice. all three insect species transmitted lethal anthrax infection ... | 1987 | 3112013 |
| insect transmission of capripoxvirus. | capripoxvirus was transmitted between sheep using stomoxys calcitrans as a vector. attempts to transmit capripoxvirus between sheep and between goats using biting lice (mallophaga species), sucking lice (damalinia species), sheep head flies (hydrotaea irritans) and midges (culicoides nubeculosus) were unsuccessful, although capripoxvirus was isolated from sheep head flies that had previously fed on infected sheep. | 1986 | 3010413 |
| role of insects in the transmission of bovine leukosis virus: potential for transmission by stable flies, horn flies, and tabanids. | the ability of stable flies (stomoxys calcitrans), horn flies (haematobia irritans), and tabanids (diptera: tabanidae) to transmit bovine leukosis virus (blv) was investigated. stable flies and horn flies were fed on blood collected from an infected cow, and the flies' mouthparts were immediately removed, placed in rpmi-1640 medium, ground, and inoculated into sheep and calves. infection of sheep occurred with mouthparts from as few as 25 stable flies or 25 horn flies. however, sheep were not in ... | 1985 | 2982293 |
| early season dispersal of muscidifurax zaraptor (hymenoptera: pteromalidae) utilizing freeze-killed housefly pupae as hosts. | the pteromalid wasp, muscidifurax zaraptor kogan and legner, was released at three locations at a dairy in may before housefly and stable fly breeding had begun. freeze-killed housefly pupae were placed adjacent to the emerging parasites at biweekly intervals for a 6-week period. hosts placed out weeks 0 and 2 were heavily parasitized. decreased parasitism in hosts placed out at week 4 suggested that many of the m. zaraptor had dispersed or died. high parasitism of hosts placed in the field at w ... | 1988 | 2980169 |
| effect of host behaviour on host preference in stomoxys calcitrans. | field observations suggest that, in the u.k., cattle are the preferred host of stomoxys calcitrans (l.), followed by horses. differences were observed in the numbers of flies feeding on individual animals both in the field and under controlled conditions. analysis of the behaviour of four friesian calves under attack from s. calcitrans in controlled conditions revealed that the differences in the levels of attack between individual hosts are dependent on the reactions of the host when under atta ... | 1987 | 2979520 |
| horse-baited insect trap and mobile insect sorting table used in a disease vector identification study. | a horse-baited trap and a mobile insect sorting table were used to conduct an arthropod survey for potential vectors of potomac horse fever in southern maryland and northern virginia. the trap and table worked effectively for the live collection and sorting of haemophagous diptera such as: simulium spp., stomoxys calcitrans, musca autumnalis, tabanus spp. and chrysops spp. during the diurnal collections periods, and culicoides spp. during the crepuscular periods. the trap was not as convenient f ... | 1988 | 2906356 |
| evaluation of the stable fly (stomoxys calcitrans) as a vector of enzootic bovine leukosis. | experiments reported here were directed at 2 questions: (1) can the stable fly (stomoxys calcitrans) transmit enzootic bovine leukosis? (2) could early viremia augment the probability of transmission by this insect? in one vector experiment, calves and bovine leukemia virus (blv)-infected cows were housed with and without stable flies. the calves were monitored serologically during a 3-month postexposure period, using the agar gel immunodiffusion test. all fly-infested and fly-free calves remain ... | 1988 | 2851955 |
| mechanical transmission of capripox virus and african swine fever virus by stomoxys calcitrans. | stomoxys calcitrans can act as an efficient mechanical vector of capripox virus and african swine fever virus. capripox virus was transmitted to a susceptible goat by flies infected 24 hours previously and the virus survived in some flies for at least four days. african swine fever virus was transmitted to susceptible pigs by flies infected one hour and 24 hours previously and the virus survived in these flies for at least two days without apparent loss of titre. | 1987 | 2820006 |
| why is alsynite fiber glass sheet attractive to stable flies? optical and behavioural studies. | the fiber glass material alsynite (sequentia corporation) is known to be an effective visual attractant to stable flies, stomoxys calcitrans. the basis for this attractiveness is not certain, but is found to correlate with high near-uv reflectivity. while examining the transmission properties of alsynite, it was found that the ratio of short- to long-wavelength photons shifts from 0.17 to 0.77, depending on the angle of the alsynite relative to the source and the detector. this shift occurs sudd ... | 1989 | 2776864 |
| the intracellular pathway and kinetics of digestive enzyme secretion in an insect midgut cell. | the opaque zone cells of the midgut of the stablefly, stomoxys calcitrans display a cyclical series of ultrastructural events in response to feeding, which it has been suggested are related to the synthesis and secretion of digestive enzymes. these cells have been studied in vivo using a combination of biochemical, morphometric and electron microscopical autoradiographic techniques. the cyclical nature, timing and relationship of the ultrastructural events to enzyme secretion has been confirmed. ... | 1989 | 2772906 |
| polyfluoro 1,3-diketones as systemic insecticides. | a series of aryl polyfluoro 1,3-diketones were examined for systemic ectoparasiticidal activity in cattle. the compounds demonstrated efficacy against several economically important species of insects and acarina. at dosages of 5 mg/kg x1 or 0.35 mg/kg per day intraruminally, activity was observed against blowfly larvae (phormia regina), adult stable fly (stomoxys calcitrans), and lone star tick (amblyomma americanum). in vivo activity was not directly related to in vitro activity, showing a str ... | 1989 | 2769686 |
| costs of existing and recommended manure management practices for house fly and stable fly (diptera: muscidae) control on dairy farms. | costs of fly control practices were estimated for 26 new york and maryland dairy farms. objectives were to characterize existing practices, compare them with the cost of more frequent and complete manure removal to reduce fly breeding, and to compare costs of manure removal and insecticide application. information was collected in scouting visits and personal interviews of farm operators. equipment, labor, and bedding costs were included for manure removal. insecticide application costs included ... | 1989 | 2768644 |
| effect of experimental bedding treatments on the density of immature musca domestica and stomoxys calcitrans (diptera: muscidae) in outdoor calf hutches. | experimental bedding materials and a novel delivery method of cyromazine (larvadex) were evaluated as replicated treatments in outdoor calf hutches for effect on the density of immature musca domestica l. and stomoxys calcitrans (l.). in 6-wk trials, overall density of musca domestica l. and stomoxys calcitrans (l.) in straw bedding averaged 36.2 and 52.6 maggots/liter, respectively, compared with respective average densities of 9.0 and 16.2 for wood chips and 10.4 and 20.0 for wood chips over a ... | 1989 | 2768642 |
| [the distribution of stomoxys calcitrans (diptera, muscidae) in stables]. | cowsheds and pigsties were studied for infestation with the stable fly. 81.5% of the cowsheds, but only 20% of the pigsties were found to be infested. both people working in the sheds and sties and villagers felt molested. the control of the stable fly proved to be not difficult. | 1989 | 2729650 |
| relative attractiveness of paired bl and blb fluorescent bulbs for house and stable flies (diptera: muscidae). | blacklight (bl) and blacklight blue (blb) fluorescent bulbs were combined in an electrocuting fly trap and compared with bl or blb bulbs alone for fly attraction. combinations of bl and blb bulbs did not attract more house flies, musca domestica, or stable flies, stomoxys calcitrans than were attracted by bl bulbs used alone. | 1989 | 2708631 |
| walk-through trap for control of horn flies (diptera: muscidae) on pastured cattle. | a walk-through fly trap designed in 1938 by w. g. bruce was tested for two field seasons in missouri. screened elements along both sides of the device functioned as cone traps, thereby catching horn flies, haematobia irritans (l.), as they were swept from cattle by strips of carpet hung from the roof. horn fly control on pastured cattle averaged 54 and 73% when they were afforded access to the trap. analyses of diptera captured in the trap indicated that horn flies comprised the most abundant sp ... | 1989 | 2708630 |
| parasites that attack stable fly and house fly (diptera: muscidae) puparia during the winter on dairies in northwestern florida. | throughout the winter and early spring months, stable fly, stomoxys calcitrans (l.), and house fly, musca domestica l., puparia were collected from silage, hay, and manure from six dairies in northwestern florida and evaluated for parasitism. of the puparia producing flies or parasites, 23% of the stable flies and 46% of the house flies were parasitized. the predominant parasite observed attacking muscoid flies (76% for stable flies and 58% for house flies) was spalangia cameroni perkins. muscid ... | 1989 | 2708626 |
| azadirachtin as a larvicide against the horn fly, stable fly, and house fly (diptera: muscidae). | effects of azadirachtin, a triterpenoid extracted from neem seed, azadirachta indica a. juss., were similar to those of insect growth regulators against the immature stages of the born fly, haematobia irritans (l.), the stable fly, stomoxys calcitrans (l.), and the house fly, musca domestica l. when an ethanolic extract of ground seed was blended into cow manure, lc50 and lc90's for larval horn flies were 0.096 and 0.133 ppm azadirachtin, respectively. an emulsifiable concentrate (ec) had an lc5 ... | 1989 | 2600264 |
| flight behavior of musca domestica and stomoxys calcitrans (diptera: muscidae) in a kansas dairy barn. | aerial density, flight thresholds, and periodicity were estimated for the house fly, musca domestica l., and the stable fly, stomoxys calcitrans (l.), from data collected by suction traps located in a dairy barn in kansas between 1 july and 31 october 1970. m. domestica catches increased from july to august, declining to near zero by the end of october. s. calcitrans catches peaked in july and september with a major decline in august. both species exhibited a diel periodicity in flight with maxi ... | 1989 | 2585444 |
| control of haematophagous flies on equines with permethrin-impregnated eartags. | the efficacy of 10% (w/w) permethrin impregnated eartags for the control of the haematophagous fly pests stomoxys calcitrans l., haematopota dissimilis meigen and hippobosca maculata leach on equines in india was determined. the tags were found to be effective for 1-2 months against s. calcitrans and h. dissimilis but completely ineffective against h. maculata. no tags were lost during the study. tags can be used as part of an integrated control programme. this is the first reported use of earta ... | 1989 | 2519656 |
| salinity tolerance of stable fly (diptera: muscidae). | effects of salinity on the survival, growth, and development of stable fly, stomoxys calcitrans (l.), were investigated in the laboratory. larvae failed to develop to pupation when reared in media containing a salinity of 40 parts per thousand (ppt) sodium chloride (nacl). maximum salinity supporting larval development equaled the salinity of seawater (34 ppt); the larval lc90 was 24.2 ppt. deleterious effects of high salinity decreased as larvae matured. six-day-old larvae reared at a salinity ... | 1990 | 2376641 |