Publications
| Title | Abstract | Year Filter | PMID(sorted descending) Filter |
|---|
| [organization of olfactory system of the indian major carp labeo rohita (ham.): a study using scanning and transmission microscopy]. | catla catla, labeo rohita, and cirrhinus mrigala are important alimentary fish in india. their reproduction (breeding) depends on season. the fish perceive external factors-stimuli and chemical signals through the olfactory system that plays the key role in the central regulation of reproduction. however, in the available literature, any electron microscopy data on organization of olfactory elements in these fish are absent. we have studied ultrastructure of the olfactory organ in male l. rohita ... | 2007 | 17725034 |
| combined effects of different food rations and sublethal copper exposure on growth and energy metabolism in common carp. | common carp (cyprinus carpio) were fed two different rations, 0.5% body weight (low ration; lr) and 5% body weight (high ration; hr), throughout acclimation, sublethal (64 microg/l) cu exposure for 28 days, and a subsequent 2-week recovery period. growth, liver water content, and liver energy stores were assessed during this period. growth rates were elevated in hr fish compared to lr fish, as was the hepatic lipid content. this was associated with a higher water content in the livers of lr fish ... | 2008 | 17721796 |
| effects of ammonia, nitrite and nitrate on hemoglobin content and oxygen consumption of freshwater fish, cyprinus carpio (linnaeus). | lethal effects of nitrogenous compounds ammonia, nitrite and nitrate on freshwater fish cyprinus carpio were studied and the static lc50 values obtained for these 3 toxicants for 24 hr were 0.80 ppb, 171.36 ppm; 1075.10 ppm and continuous flowthrough lc50 values for 24 hr were 0.72 ppb, 154.31 ppm; 967.63 ppm respectively. the fish were exposed to lethal concentrations to study the changes in hematological parameters and the rate of oxygen consumption. during the period of exposure general decli ... | 2007 | 17717984 |
| maternal balanced translocation (4;21) leading to an offspring with partial duplication of 4q and 21q without phenotypic manifestations of down syndrome. | we describe an 8-years old female with supernumerary chromosome der(21)t(4;21)(q25;q22) resulting in partial trisomy 4q25-qter and partial trisomy 21(pter-q22). the extra material was originated from a reciprocal balanced translocation carrier mother (4q;21q). karyotyping was confirmed by fish using whole chromosome painting probes for 4 and 21q and using 21q22.13-q22.2 specific probe to rule out trisomy of down syndrome critical region. phenotypic and cytogenetic findings were compared with pre ... | 2007 | 17710874 |
| cross-reactivity of human leukocyte differentiation antigen monoclonal antibodies on carp and rainbow trout cells. | three hundred and seventy-seven monoclonal antibodies (mabs) directed against human cd antigens and non-classified human leukocyte surface antigens were assayed for their reactivity with common carp (cyprinus carpio l.) and rainbow trout (oncorhynchus mykiss) peripheral blood leukocytes (pbl) and thymocytes within the animal homologue section of the 8th international workshop on human leukocyte differentiation antigens (hlda8). four of the mabs clearly reacted with rainbow trout pbl and two with ... | 2007 | 17707517 |
| antiproliferative effects and apoptosis induction by probiotic cytoplasmic extracts in fish cell lines. | probiotic bacteria are known to exert a wide range of beneficial effects on their animal hosts. control of intestinal homeostasis, inflammation suppression and a reduction in the incidence of cancer all rely on the antiproliferative potential of probiotics. in this paper, we assess the antiproliferative activity of probiotics in two teleost fish cell lines saf-1, a fibroblast cell line and epc, an epithelioma from carp. cells were grown in the presence of cytoplasmic extracts obtained from two b ... | 2008 | 17706899 |
| the zebrafish erythropoietin: functional identification and biochemical characterization. | in the present study, the zebrafish epo cdna was cloned. the encoded protein displays 90%, 55% and 32% identity to the epo from carp, fugu and human, respectively. through rt-pcr, the expression of zepo mrna was mainly in the heart and liver. in the cos-1 cell transfection experiments, the recombinant zepo-ha protein was efficiently secreted into the culture medium as a glycoprotein and the carbohydrate moiety can be cleaved by the treatment of peptide-n-glycosidase f (pngase f). using the morph ... | 2007 | 17706649 |
| melatonin in the regulation of annual testicular events in carp catla catla: evidence from the studies on the effects of exogenous melatonin, continuous light, and continuous darkness. | the physiological significance of melatonin in the regulation of annual testicular events in a major carp catla catla was evaluated through studies on the effects of graded dose (25, 50, or 100 microg/100 g body wt.) of melatonin exogenously administered for different durations (1, 15, or 30 days) and manipulation of the endogenous melatonin system by exposing the fish to constant darkness (dd) or constant light (ll) for 30 days. an identical experimental schedule was followed during the prepara ... | 2007 | 17701677 |
| action of ascorbic acid on a myosin molecule derived from carp. | the influence of l-ascorbic acid at 40 degrees c incubation on the subfragment-1 and rod regions, prepared by chymotryptic digestion of myosin, and myosin was investigated by sds-polyacrylamide gel electrophoresis and transmission electron microscopy respectively. it was observed that l-ascorbic acid acted more readily on the subfragment-1 region of myosin. further, circular dichroism measurement indicated that l-ascorbic acid did not affect the structure of myosin. these results suggest that l- ... | 2007 | 17690444 |
| a progestin and an estrogen regulate early stages of oogenesis in fish. | using two species of teleost fish, japanese huchen (hucho perryi) and common carp (cyprinus carpio), we investigated whether sex steroids are involved in early oogenesis in vitro. ovarian fragments were cultured to examine the effects of a progestin, 17alpha, 20beta-dihydroxy-4-pregnen-3-one (dhp), and an estrogen, estradiol-17 beta (e2). dhp and e2 significantly promoted dna synthesis in ovarian germ cells, as judged by 5-bromo-2-deoxyuridine (brdu) incorporation into these cells. furthermore, ... | 2007 | 17687117 |
| isolation and characterization of alpha1-proteinase inhibitor from common carp (cyprinus carpio) seminal plasma. | using a three-step procedure, we purified (79 and 51.6-fold to homogeneity) and characterized the two isoforms (a and b) of alpha1-proteinase inhibitor-like protein from carp seminal plasma. the isoforms have molecular masses of 55.5 and 54.0 kda, respectively. these inhibitors formed sds-stable complexes with cod and bovine trypsin, chymotrypsin and elastase. the thirty-three amino acids within the reactive loop slpdtvilnrpflvlivedttksilfmgkitnp were identified for isoform b. the same first ten ... | 2007 | 17681818 |
| nationwide study of dioxins in the freshwater fish carassius auratus (gibelio) langsdorfii (crucian carp) in japan: concentrations and estimation of source contribution ratios. | we investigated dioxin concentrations in freshwater fish in japan by standardizing species to detect subtle decreasing trends of dioxin concentrations in the future with the reinforcement of regulations. the fish studied were crucian carp (carassius auratus (gibelio) langsdorfii), an omnivorous species. fish and sediments were collected from 14 rivers and lakes located in remote areas, agricultural areas, and small and large cities throughout japan. the total toxic equivalent (teq) dioxin concen ... | 2007 | 17675214 |
| microbiological quality of fish grown in wastewater-fed and non-wastewater-fed fishponds in hanoi, vietnam: influence of hygiene practices in local retail markets. | mean water quality in two wastewater-fed ponds and one non-wastewater-fed pond in hanoi, vietnam was approximately 10(6) and approximately 10(4) presumptive thermotolerant coliforms (pthc) per 100 ml, respectively. fish (common carp, silver carp and nile tilapia) grown in these ponds were sampled at harvest and in local retail markets. bacteriological examination of the fish sampled at harvest from both types of pond showed that they were of very good quality (2 - 3 pthc g(-1) fresh muscle weigh ... | 2007 | 17674570 |
| altered serum levels of sex steroids and biotransformation enzyme activities by long-term alachlor exposure in crucian carp (carassius auratus). | 2007 | 17668140 | |
| the effect of food rations on tissue-specific copper accumulation patterns of sublethal waterborne exposure in cyprinus carpio. | common carp (cyprinus carpio) were fed to two different food rations, 0.5% body weight (low ration [lr]) and 5% body weight (high ration [hr]), and were exposed to sublethal (1 microm) copper levels for 28 d in softened antwerp (belgium) city tap water (ca2+, 79.3 mg/l; mg2+, 7.4 mg/l; na+, 27.8 mg/l; ph 7.5-8.0). copper accumulations in the liver, gills, kidney, anterior intestine, posterior intestine, and muscle were determined. copper accumulation in the gills, liver, and kidney of lr fish wa ... | 2007 | 17665693 |
| the effects of three organic chemicals on the upper thermal tolerances of four freshwater fishes. | the upper temperature tolerance limits of four freshwater fish species, silver perch bidyanus bidyanus, eastern rainbowfish melanotaenia duboulayi, western carp gudgeon hypseleotris klunzingeri, and rainbow trout oncorhynchus mykiss, were determined using the critical thermal maximum (ctmaximum) method. the ctmaximum tests were carried out with unexposed fish and fish exposed to sublethal concentrations of endosulfan, chlorpyrifos, and phenol to determine whether or not the ctmaximum was affecte ... | 2007 | 17665686 |
| differential transcription of multiple forms of alpha-2-macroglobulin in carp (cyprinus carpio) infected with parasites. | alpha-2-macroglobulin (a2m) is a non-specific protease inhibitor involved in host defense mechanisms, inhibiting both endogenous and exogenous proteases. it is unique among the plasma anti-proteases with respect to the diversity of proteases that it can inactivate. carp a2m consists of an alpha and beta chain of which the first includes the bioactive regions. previously, three a2m alpha chain sequences were reported for east-asian common carp. we studied a2m alpha chain variability in european c ... | 2008 | 17662386 |
| linking human nutrition and fisheries: incorporating micronutrient-dense, small indigenous fish species in carp polyculture production in bangladesh. | fish and fisheries are important for the livelihoods, food, and income of the rural population in bangladesh. increased rice production and changing agricultural patterns have resulted in a large decline in inland fisheries. implementation of carp pond polyculture has been very successful, whereas little focus has been given to the commonly consumed small indigenous fish species, some of which are rich in vitamin a and minerals, such as calcium, iron, and zinc, and are an integral part of the ru ... | 2007 | 17658074 |
| using semipermeable membrane devices, bioassays, and chemical analysis for evaluation of bioavailable polycyclic aromatic hydrocarbons in water. | meiliang bay is a sublake of taihu lake and has been polluted by domestic and industrial effluents. as part of a comprehensive risk assessment project in this region, semipermeable membrane devices (spmds) were applied to evaluate the levels and potential toxic potency of polycyclic aromatic hydrocarbons (pahs) in lakewater, in combination with chemical analysis and in vitro bioassay using h4iie rat hepatoma cells. in addition, induction of hepatic ethoxyresorufin-o-deethylase (erod) activity, i ... | 2007 | 17657463 |
| genome-wide mapping of modifier chromosomal loci for human hypertrophic cardiomyopathy. | hypertrophic cardiomyopathy (hcm) is a disease of mutant sarcomeric proteins (except for phenocopy). cardiac hypertrophy is the clinical diagnostic hallmark of hcm and a major determinant of morbidity and mortality in various cardiovascular diseases. however, there is remarkable variability in expression of hypertrophy, even among hcm patients with identical causal mutations. we hypothesized modifier genes are partly responsible for the variation in hypertrophic expressivity. to map the modifier ... | 2007 | 17652099 |
| [analysis of genetic diversity among silver carp populations in the middle and lower yangtse river using thirty microsatellite markers]. | thirty microsatellite markers were used to analyze the genetic diversity of five silver carp populations in the middle and lower reaches of the yangtze river. a total of 144 different alleles were found and the number of alleles in each locus ranged from 1 to 10. twenty-five loci (83.33%) were polymorphic. in the five populations, the average number of alleles was 4.0 to 4.1, the number of mean valid alleles was 2.4445 to 2.6332, the value of average observed and expected heterozygosity ranged f ... | 2007 | 17650488 |
| studies on resistance characteristic and cdna sequence conservation of transferrin from crucian carp, carassius auratus. | transferrin (tf) is a kind of non-heme beta-globulin with two iron ions (fe(3+))-binding sites. to prove tf's physiological functions, fe(3+)-proteins, serum iron contents, and total iron-binding capabilities were tested for tfs of crucian carps (carassius auratus) and sliver carps (hypophthalmichthys molitrix). the above results demonstrated that sliver carps shared 1/3 tf alleles with crucian carps; tf of crucian carps had stronger fe(3+)-binding ability and transportation ability in plasma th ... | 2007 | 17646932 |
| presence and inducibility by beta-naphthoflavone of cyp1a1, cyp1b1 and phase ii enzymes in trematomus bernacchii, an antarctic fish. | this study investigated some aspects of xenobiotic metabolism in the nototheniidae trematomus bernacchii, a key sentinel species for monitoring antarctic ecosystems. after laboratory exposure to beta-naphthoflavone (betanf), basal levels and time-course induction of cyp1a, cyp1b and cyp3a were measured as enzymatic activities, immunoreactive protein content and mrna expression in liver, gills, intestine and heart. additional analyses in the liver included enzymatic activities of testosterone hyd ... | 2007 | 17643506 |
| debromination of polybrominated diphenyl ether-99 (bde-99) in carp (cyprinus carpio) microflora and microsomes. | based on previous findings in dietary studies with carp (cyprinus carpio), we investigated the mechanism of 2,2',4,4',5-pentabromodiphenyl ether (bde-99) debromination to 2,2',4,4'-tetrabromodiphenyl ether (bde-47) using liver and intestinal components. in vitro aerobic and anaerobic experiments tested the ability of carp intestinal microflora to debrominate bde-99. no debromination of bde-99 to bde-47 was observed in microfloral samples; therefore, carp enzymatic pathways were assessed for debr ... | 2007 | 17640709 |
| the toxicity of copper to crucian carp (carassius carassius) in soft water. | crucian carp (carassius carassius) were exposed to a cu rich medium (ph 6.6, conductivity 25 micros/cm, 2.91 mg ca(2+)/l, approximately 300 microg cu(2+)/l). untreated department water (ph 6.6, conductivity 25 micros/cm, 2.91 mg ca(2+)/l) acted as control. mortality in crucian carp was first observed after 13 days of exposure to the cu rich medium. there were, however, significant changes in haematocrit, plasma chloride, plasma sodium and water content in muscle in fish exposed to the cu rich me ... | 2007 | 17628637 |
| molecular cloning and expression analysis of t-bet in ginbuna crucian carp (carassius auratus langsdorfii). | in the adaptive immune system of mammals, naive helper t (th) cells differentiate into th1 or th2 cells. the t-box expressed in t cells (t-bet) is a member of a family of t-box transcription factors that regulates the expression of ifn-gamma and plays a crucial role in th1 cell differentiation and cell-mediated immunity. we cloned and sequenced t-bet cdna for the first time from non-mammalian species, ginbuna crucian carp. ginbuna t-bet was composed of 608 predicted amino acids and showed 41.5% ... | 2008 | 17624433 |
| global cooling: cold acclimation and the expression of soluble proteins in carp skeletal muscle. | the common carp (cyprinus carpio) has a well-developed capacity to modify muscle properties in response to changes in temperature. understanding the mechanisms underpinning this phenotypic response at the protein level may provide fundamental insights into the molecular basis of adaptive processes in skeletal muscle. in this study, common carp were subjected to a cooling regimen and soluble extracts of muscle homogenates were separated by 1-d sds-page and 2-de. proteins were identified using mal ... | 2007 | 17623276 |
| prevalence of fishborne zoonotic parasites in important cultured fish species in the mekong delta, vietnam. | a seasonal investigation on the occurrence of fishborne zoonotic trematodes (fzt) in economically important mono-cultured hybrid catfish and giant gouramy was conducted in the mekong delta of vietnam. fish from carp poly-culture and intensive small-scale integrated vegetable-aquaculture-animal husbandry farming (vac) systems were also examined. no fzt metacercariae were found in any mono-cultured hybrid catfish. fzt metacercariae were common, however, in fish from the other three systems: all me ... | 2007 | 17618460 |
| acute toxicity of antimony chloride and its effects on oxygen consumption of common carp (cyprinus carpio). | the purposes of this study were to investigate the acute toxicity and effects of sublethal antimony (sb) concentrations on respiratory activity changes in the common carp (cyprinus carpio). median lethal concentrations were determined in acute tests. the 96-h lc50 value was 14.05 (11.09~17.80) mg l(-1). common carp were exposed to 4 different sublethal levels of antimony (1.0, 2.0, 4.0, and 8.0 mg l(-1)) over a 28-day test period and a 14-day recovery period. on days 14 and 28, decreases in oxyg ... | 2007 | 17618378 |
| a comparative study on innate immune parameters in the epidermal mucus of various fish species. | fish epidermal mucus and its components provide the first line of defense against pathogens. little is known about the role of epidermal mucus enzymes in the innate immune system of fish species such as arctic char (salvelinus alpinus), brook trout (s. fontinalis), koi carp(cyprinus carpio), striped bass (morone saxatilis), haddock, (melanogrammus aeglefinus), atlantic cod (gadus morhua) and hagfish (myxine glutinosa). the epidermal mucus samples from these fish were analysed for the specific ac ... | 2007 | 17618153 |
| on the role of nr3a in human nmda receptors. | in the present paper we describe our on-going project investigating the functional roles of the n-methyl-d-aspartate (nmda) receptor subunit nr3a. we find that nr3a mrna is abundant both in embryonic and adult human brain, in contrast to the almost non-existing expression in adult rodent brain. human nr3a (hnr3a) protein expression is particularly abundant in the cerebral cortex, as shown by western blot using nr3a-specific antibodies. distribution of hnr3a in adult human brain shows a similar p ... | 2007 | 17617428 |
| actin filament organization of foot processes in vertebrate glomerular podocytes. | we investigated the actin filament organization and immunolocalization of actin-binding proteins (alpha-actinin and cortactin) in the podocyte foot processes of eight vertebrate species (lamprey, carp, newt, frog, gecko, turtle, quail, and rat). three types of actin cytoskeleton were found in these foot processes. (1) a cortical actin network with cortactin filling the space between the plasma membrane and the other actin cytoskeletons described below was found in all of the species examined her ... | 2007 | 17605050 |
| gill remodeling in fish--a new fashion or an ancient secret? | while a large respiratory surface area is good for gas exchange, it also poses several problems, including energetically unfavorable fluxes of water and ions. as a result, fishes appear to have a respiratory surface area that is matched to their oxygen demands. when faced with changes in their need for oxygen uptake, e.g. through altered physical activity or altered ambient oxygen levels, fishes have long been known to make two different adjustments: (1) to change the water flow over the gills o ... | 2007 | 17601943 |
| [the effects of parasites on the growth of the crucian carp (carassius carassius l., 1758) inhabiting the kovada lake]. | the aim of this study carried out between march 2003-february 2004 was to determine the effects of parasites on the growth of the crucian carp (carassius carassius l., 1758) inhabiting the kovada lake. a total of 102 specimens were caught monthly and investigated parasitologically. the age distribution of these fish were found to be between 3-7 years and 54 (52.9%) were infected by the various parasites. investigations of fish that were caught during the same month of the same sex and of the sam ... | 2007 | 17594663 |
| the nuclear phenotypic plasticity observed in fish during rrna regulation entails cajal bodies dynamics. | cajal bodies (cbs) are small mobile organelles found throughout the nucleoplasm of animal and plant cells. the dynamics of these organelles involves interactions with the nucleolus. the later has been found to play a substantial role in the compensatory response that evolved in eurythermal fish to adapt to the cyclic seasonal habitat changes, i.e., temperature and photoperiod. contrary to being constitutive, rrna synthesis is dramatically regulated between summer and winter, thus affecting ribos ... | 2007 | 17588531 |
| the complete mitochondrial genome of the chinese hook snout carp opsariichthys bidens (actinopterygii: cypriniformes) and an alternative pattern of mitogenomic evolution in vertebrate. | the complete mitochondrial genome sequence of the chinese hook snout carp, opsariichthys bidens, was newly determined using the long and accurate polymerase chain reaction method. the 16,611-nucleotide mitogenome contains 13 protein-coding genes, two rrna genes (12s, 16s), 22 trna genes, and a noncoding control region. we use these data and homologous sequence data from multiple other ostariophysan fishes in a phylogenetic evaluation to test hypothesis pertaining to codon usage pattern of o. bid ... | 2007 | 17587513 |
| carp (cyprinus carpio) vitellogenin: characterization of yolk proteins, development of immunoassays and use as biomarker of exposure to environmental estrogens. | the precursor protein of egg yolk, vitellogenin (vg), is cleaved into three major components (lipovitellin, phosvitin and beta'-component) at the time of incorporation by growing oocytes. we purified three yolk proteins (yp1, yp2 and yp3) from ovaries of the common carp (cyprinus carpio) by a combined method of ammonium sulfate precipitation and column chromatography. biochemical analyses of the purified proteins of this species suggest that yp1, yp2 and yp3 are lipovitellin, beta'-component and ... | 2007 | 17585296 |
| ecotoxicological assessment of water pollution in sariyar dam lake, turkey. | given the effects of environmental pollution and different biotic factors on some important biochemical markers, as enzymes, two fish species inhabiting the sariyar dam lake, turkey have been investigated. ethoxyresorufin o-deethylase, glutathion s-transferase, lactate dehydrogenase, alkaline phosphatase, acid phosphatase, and alanine and aspartate amino transferase activities have been measured in liver samples of cyprinus carpio and capoeta tinca. also, brain acetylcholinesterase and carboxyle ... | 2008 | 17582495 |
| carp versus cranium: a fishy story. | issues of drowning or near drowning in aquatic sporting have received considerable attention in the literature; however, there is not a lot of attention to nonsubmersion injuries such as water tubing. water tubing is similar to water skiing but with much less control by the rider, leaving the rider at the mercy of the driver or any obstacle in their path. this report describes unusual events surrounding the injury of a 5-year-old boy enjoying water fun with his father on his boat. the importance ... | 2007 | 17579328 |
| functional characterisation of ucp1 in the common carp: uncoupling activity in liver mitochondria and cold-induced expression in the brain. | mammalian uncoupling protein 1 (ucp1) mediates nonshivering thermogenesis in brown adipose tissue. we previously reported on the presence of a ucp1 orthologue in ectothermic fish and observed downregulation of ucp1 gene expression in the liver of the common carp. neither the function of ucp1, nor the mode of ucp1 activation is known in carp liver mitochondria. here, we compared the proton conductance at 25 degrees c of liver mitochondria isolated from carp either maintained at 20 degrees c (warm ... | 2007 | 17576568 |
| sequential ultrastructural and biochemical changes induced in vivo by the hepatotoxic microcystins in liver of the phytoplanktivorous silver carp hypophthalmichthys molitrix. | up to now, in vivo studies on the toxic effects of microcystins (mcs) on the ultrastructures of fish liver have been very limited. the phytoplanktivorous silver carp was injected i.p. with extracted hepatotoxic microcystins (mainly mc-rr and -lr) at a dose of 1000 microg mc-lreq. kg(-1) body weight, showing a time-dependent ultrastructural change in liver as well as significant increases in enzyme activity of plasma alanine aminotransferase (alt), aspartate aminotransferase (ast) and lactate deh ... | 2007 | 17574927 |
| comparison of the uptake of polycyclic aromatic hydrocarbons and organochlorine pesticides by semipermeable membrane devices and caged fish (carassius carassius) in taihu lake, china. | uptake of polycyclic aromatic hydrocarbons (pahs) and organochlorine pesticides (ocps) by triolein-containing semipermeable membrane devices (spmds) and by crucian carp (carassius carassius) was studied in taihu lake, a shallow, freshwater lake in china. crucian carp and spmds were deployed side by side for 32 d. the first-order uptake rate constants of individual pahs and ocps for the two matrices were calculated and compared to relate the amounts of chemicals accumulated by the matrices to dis ... | 2007 | 17571693 |
| kinematics, hydrodynamics and energetic advantages of burst-and-coast swimming of koi carps (cyprinus carpio koi). | koi carps frequently swim in burst-and-coast style, which consists of a burst phase and a coast phase. we quantify the swimming kinematics and the flow patterns generated by the carps in burst-and-coast swimming. in the burst phase, the carps burst in two modes: in the first, the tail beats for at least one cycle (multiple tail-beat mode); in the second, the tail beats for only a half-cycle (half tail-beat mode). the carp generates a vortex ring in each half-cycle beat. the vortex rings generate ... | 2007 | 17562892 |
| morphological and genetic differences of trypanosoma in some chinese freshwater fishes: difficulties of species identification. | blood smears and purified trypanosome from freshwater fishes yellow catfish (pseudobagras fulvidraco) and common carp (cyprinus carpio) captured from niushan lake, hubei province were examined to determine whether all of their trypanosomes were trypanosoma pseudobagri, a species of supposed host specificity and widespread existence across china. trypanosomes occurred in 16/16 blood smears, and morphometric character analysis of trypanosomes from these smears showed that there were three morphosp ... | 2007 | 17558522 |
| [3h] muscimol receptors sites in the carp (cyprinus carpio l.) brain: binding assay and autoradiographic distribution. | autoradiographic and binding techniques were used to study the presence of [(3)h]muscimol receptors sites in the carp brain. the radioligand was distributed with an high degree of anatomical selectivity. we found abundant labelling in the cerebellum, in the nucleus diffusus lobi inferioris, and in the torus longitudinalis. no labelling was detected within the epithalamus, thalamus and hypothalamus, while the telencephalon and the rhombencephalon displayed a low density of [(3)h]muscimol receptor ... | 2007 | 17553715 |
| evidence for maternal inheritance of mitochondrial dna in allotetraploid. | the complete mitochondrial dna (mtdna) sequences of the allotetraploid and red crucian carp were determined in this paper. we compared the complete mtdna sequences between the allotetraploid and its female parent red crucian carp, and between the allotetraploid and its male parent common carp. the results indicated that the complete mtdna nucleotide identity (99.7%) between the allotetraploid and its female parent red crucian carp was higher than that (89.0%) between the allotetraploid and its m ... | 2007 | 17541829 |
| corticotropin-releasing factor (crf) and crf-binding protein expression in and release from the head kidney of common carp: evolutionary conservation of the adrenal crf system. | corticotropin-releasing factor (crf) plays a central role in the regulation of the stress axis. in mammals, crf as well as its receptors and its crf-binding protein (crf-bp) are expressed in a variety of organs and tissues outside the central nervous system. one of these extrahypothalamic sites is the adrenal gland, where the paracrine actions of adrenal crf influence cortical steroidogenesis and adrenal blood flow. although the central role of crf signaling in the initiation and regulation of t ... | 2007 | 17535873 |
| the fine structural organization of the olfactory epithelium of cyprinus carpio (linnaeus): a scanning electron microscopic study. | the fine anatomical structures of the olfactory epithelium of cyprinus carpio (linnaeus) have been systematically studied with the help of the scanning electron microscope (sem). the olfactory rosette is an oval structure composed of a number of lamellae arranged on a median raphe. a large part of the lateral surface of the rosette is covered with non-receptor epithelium, whereas the receptor epithelium occupies a much smaller area in the middle part. the nonreceptor epithelium is covered with a ... | 2007 | 17533588 |
| direct evidence for interaction between lead ions and kidney dna from silver crucian carp. | a direct interaction of lead (pb) with kidney dna from silver crucian carp (carassius auratus gibelio) has been systematically studied in vitro using multi-techniques, including uv-vis absorption, extended x-ray absorption fine structure, vacuum ultraviolet circular dichroism spectral methods and gel electrophoresis. we find that pb is bound with four oxygen or nitrogen atoms of dna in its fresh shell at the distances of 2.64 a. additionally, pb may bind to the oxygen atom of nucleic acid or nit ... | 2007 | 17517428 |
| transactivator of transcription-tagged cell cycle and apoptosis regulatory protein-1 peptides suppress the growth of human breast cancer cells in vitro and in vivo. | deregulated signaling by the epidermal growth factor receptor family of proteins is encountered in human malignancies including breast cancer. cell cycle and apoptosis-regulatory protein-1 (carp-1), a novel, perinuclear phosphoprotein, is a regulator of apoptosis signaling by epidermal growth factor receptors. carp-1 expression is diminished in human breast cancers, and correlates inversely with human breast cancer grades which could be attributed to increased methylation. the expression of carp ... | 2007 | 17513614 |
| the effects of anticoagulants on hematological indices and blood cell morphology of common carp (cyprinus carpio l.). | hematological parameters (ht, hb, rbc, wbc, plt), erythrocyte size, and osmotic fragility, differential leukocyte count, ros production in common carp blood collected on three anticoagulants: heparin (10 iu/ml, na2edta (0.1, 0.5, and 1 mg/ml), and sodium citrate (0.3 mg/ml) were compared. na2edta caused partial blood hemolysis in ht tubes which made ht measurement impossible, and resulted in high variability of the results. both, citrate and na2edta increased sensitivity of red blood cells to he ... | 2007 | 17509941 |
| the formation of the polyploid hybrids from different subfamily fish crossings and its evolutionary significance. | this study provides genetic evidences at the chromosome, dna content, dna fragment and sequence, and morphological levels to support the successful establishment of the polyploid hybrids of red crucian carp x blunt snout bream, which belonged to a different subfamily of fish (cyprininae subfamily and cultrinae subfamily) in the catalog. we successfully obtained the sterile triploid hybrids and bisexual fertile tetraploid hybrids of red crucian carp (rcc) (female symbol) x blunt snout bream (bsb) ... | 2007 | 17507678 |
| carbonic anhydrases as drug targets--an overview. | at least 15 different alpha-carbonic anhydrase (ca, ec 4.2.1.1) isoforms were isolated in mammals, where these zinc enzymes play crucial physiological roles. some of these isozymes are cytosolic (ca i, ca ii, ca iii, ca vii, ca xiii), others are membrane-bound (ca iv, ca ix, ca xii, ca xiv and ca xv), ca va and ca vb are mitochondrial, and ca vi is secreted in saliva and milk. three acatalytic forms are also known, the ca related proteins (carp), carp viii, carp x and carp xi. representatives of ... | 2007 | 17504127 |
| seasonal variations of heavy metals in some organs of carp (cyprinus carpio l., 1758) from beyşehir lake (turkey). | in this study which was carried out between march 2003 and february 2005 fe, cu, zn, mn, cr, pb and cd contents were determined in muscle, liver and gill of carp (cyprinus carpio l., 1758) caught from beyşehir lake. among the heavy metals analyzed cr, pb and cd were below the detection limit (<0.03). heavy metal concentrations varied significantly depending on the type of the tissue and season. the highest metal concentrations were found in the liver, followed by gill and muscle. heavy metal lev ... | 2008 | 17503200 |
| dominant pathogenic species of mesophilic aeromonads isolated from diseased and healthy fish cultured in poland. | aeromonas isolates were collected from cultured fish, characterized phenotypically and identified to species using 16s rdna. the pathogenicity of all isolates was assayed on the basis of haemolytic and proteolytic activity and challenge tests were performed for isolates from healthy fish. a total of 131 aeromonas isolates were obtained and identified as follows: a. hydrophila (13), a. bestiarum (23), a. salmonicida (motile biogroup) (19), a. caviae (2), a. sobria (18), a. veronii bt. sobria (42) ... | 2007 | 17501739 |
| susceptibility of cyprinid cultured cells to cyprinid herpesvirus 3. | cyprinid herpesvirus 3 is a highly contagious and lethal virus that affects ornamental koi and common carp worldwide. however, it is not yet known whether other cyprinids are infected and/or harbor the virus. here, we report that cultured cells derived from common carp, koi, silver carp and goldfish allow cyhv-3 propagation, while cyprinid cells derived from fathead minnow and non-cyprinid cells derived from the channel catfish ovary are resistant to cyhv-3 infection. interestingly, the epitheli ... | 2007 | 17497237 |
| organization of the torus longitudinalis in the rainbow trout (oncorhynchus mykiss): an immunohistochemical study of the gabaergic system and a dii tract-tracing study. | the torus longitudinalis (tl) is a tectum-associated structure of actinopterygian fishes. the organization of the tl of rainbow trout was studied with nissl staining, golgi methods, immunocytochemistry with antibodies to gamma-aminobutyric acid (gaba), glutamic acid decarboxylase (gad), and the gaba(a) receptor subunits delta and beta2/beta 3, and with tract tracing methods. two types of neuron were characterized: medium-sized gabaergic neurons and small gaba-negative granule cells. gaba(a) rece ... | 2007 | 17492628 |
| protection against atypical aeromonas salmonicida infection in carp (cyprinus carpio l.) by oral administration of humus extract. | humic substances are formed during the decomposition of organic matter in humus, and are found in many natural environments in which organic materials and microorganisms have been present. in the present study, oral administration of humus extract to common carp (cyprinus carpio l.) induced effective protection against experimental atypical aeromonas salmonicida infection. mortality of fish and development of skin lesions such as hemorrhages and ulcers were significantly suppressed in carp treat ... | 2007 | 17485929 |
| a recombinant hypoallergenic parvalbumin mutant for immunotherapy of ige-mediated fish allergy. | ige-mediated allergy to fish is a frequent cause of severe anaphylactic reactions. parvalbumin, a small calcium-binding protein, is the major fish allergen. we have recently isolated a cdna coding for carp parvalbumin, cyp c 1, and expressed in escherichia coli a recombinant cyp c 1 molecule, which contained most ige epitopes of saltwater and freshwater fish. in this study, we introduced mutations into the calcium-binding domains of carp parvalbumin by site-directed mutagenesis and produced in e ... | 2007 | 17475857 |
| complex physiological traits as biomarkers of the sub-lethal toxicological effects of pollutant exposure in fishes. | complex physiological traits, such as routine aerobic metabolic rate or exercise performance, are indicators of the functional integrity of fish that can reveal sub-lethal toxicological effects of aquatic pollutants. these traits have proved valuable in laboratory investigations of the sub-lethal effects of heavy metals, ammonia and various xenobiotics. it is not known, however, whether they can also function as biomarkers of the complex potential range of effects upon overall functional integri ... | 2007 | 17475615 |
| carbonic anhydrases as targets for medicinal chemistry. | carbonic anhydrases (cas, ec 4.2.1.1) are zinc enzymes acting as efficient catalysts for the reversible hydration of carbon dioxide to bicarbonate. 16 different alpha-ca isoforms were isolated in mammals, where they play crucial physiological roles. some of them are cytosolic (ca i, ca ii, ca iii, ca vii, ca xiii), others are membrane-bound (ca iv, ca ix, ca xii, ca xiv and ca xv), ca va and ca vb are mitochondrial, and ca vi is secreted in saliva and milk. three acatalytic forms are also known, ... | 2007 | 17475500 |
| perexilibacter aurantiacus gen. nov., sp. nov., a novel member of the family 'flammeovirgaceae' isolated from sediment. | a strictly aerobic, gram-negative, gliding, dull-orange-pigmented, rod-shaped bacterium, designated strain shu-f-uv2-2(t), was isolated from sediment (carp island, republic of palau) and was the focus of a polyphasic taxonomic study. phylogenetic analyses based on the 16s rrna gene sequence revealed that the novel isolate was affiliated to the family 'flammeovirgaceae' of the phylum bacteroidetes and that it showed highest sequence similarity (85.5 %) to flammeovirga yaeyamensis nbrc 100898(t). ... | 2007 | 17473242 |
| population dynamics and maturation cycle of camallanus cotti (nematoda: camallanidae) in the chinese hooksnout carp opsariichthys bidens (osteichthyes: cyprinidae) from a reservoir in china. | the seasonal population dynamics and maturation cycle of the nematode camallanus cotti in the posterior intestine of chinese hooksnout carp opsariichthys bidens have been studied in the danjiangkou reservoir of the hubei province in central china from september 2004 to november 2005. the overall prevalence, mean abundance and intensity of c. cotti among fish sampled (n=700 fish) were 47%, 2.29+/-12.38 (+/-s.d.) and 1-307 (average 4.89+/-17.74), respectively. the overall sexual ratio of female to ... | 2007 | 17459589 |
| comparison of serum vitellogenin, steroid hormone, gonad histopathology and bioaccumulation in common carp (cyprinus carpio) of two rivers and a lake in japan: potential for endocrine disruption. | to investigate endocrine disruption and chemical contaminant levels in the aquatic environment, serum vitellogenin (vtg) induction, steroid hormone synthesis, gonad histopathology and nonylphenol (np) bioaccumulation were measured in common carp (cyprinus carpio) in three sites (two rivers and one lake, in which high, medium, and low np concentrations were detected in a previous study) in japan from november 2001 to february 2002. the average gonadosomatic indexes (gsis) for males were 3.9% in t ... | 2007 | 17450120 |
| complementary dna cloning and organ expression of cytochrome p450 1c2 in carp (cyprinus carpio). | cytochrome p450 (cyp) genes, which make up a large gene superfamily, are known to play an important role in drug metabolism. the cyp1 family, one of the gene families of the cyp superfamily, has three subfamilies of genes whose sequences have been deposited in the genbank/embl thus far: cyp1a, cyp1b, and cyp1c. mammals as well as fish confront numerous foreign chemicals in the environment that may accumulate to toxic levels unless they are metabolized and eliminated by processes largely mediated ... | 2007 | 17450118 |
| interpreting physiological responses to environmental change through gene expression profiling. | identification of differentially expressed genes in response to environmental change offers insights into the roles of the transcriptome in the regulation of physiological responses. a variety of methods are now available to implement large-scale gene expression screens, and each method has specific advantages and disadvantages. construction of custom cdna microarrays remains the most popular route to implement expression screens in the non-model organisms favored by comparative physiologists, a ... | 2007 | 17449823 |
| phylogenetic analysis of intestinal bacteria and their adhesive capability in relation to the intestinal mucus of carp. | the aims of the present study are to characterize the intestinal microbial community displaying a high-adhesive capability in fish, and to evaluate the relationship between mucosal adhesion of intestinal bacteria and fish health and disease. | 2007 | 17448166 |
| characterization of complete genome sequence of the spring viremia of carp virus isolated from common carp (cyprinus carpio) in china. | the complete genome of spring viraemia of carp virus (svcv) strain a-1 isolated from cultured common carp (cyprinus carpio) in china was sequenced and characterized. reverse transcription-polymerase chain reaction (rt-pcr) derived clones were constructed and the dna was sequenced. it showed that the entire genome of svcv a-1 consists of 11,100 nucleotide base pairs, the predicted size of the viral rna of rhabdoviruses. however, the additional insertions in bp 4633-4676 and bp 4684-4724 of svcv a ... | 2007 | 17447109 |
| establishment of the diploid gynogenetic hybrid clonal line of red crucian carp x common carp. | this study investigated the gynogenetic cytobiological behavior of the third gynogenetic generation (g(3)), which was generated from the diploid eggs produced by the second gynogenetic generation (g(2)) of red crucian carp x common carp, and determined the chromosomal numbers of g(3), g(2)xscatter scale carp and g(2)xallotetraploid hybrids of red crucian carp x common carp. the results showed that the diploid eggs of g(2) with 100 chromosomes, activated by uv-irradiated sperm from scatter scale ... | 2007 | 17447025 |
| [ecological bases of the combination of natural foci of trematoda infections in the floodplain-river ecosystem of the konda river. communication 2. host population-combined foci of trematoda infections]. | in the context of the present-day teaching of parasitocenoses and the proposition that the pathogen's population is the only compulsory and specific component of a natural focus, the author discloses the ecological bases of the combination of natural foci of opisthorchiasis and methorchiasis (m. bilis), methorchiasis (m. bilis) and methorchiasis (m. xanthosomus). these foci are host population-combined. while analyzing the combination of foci, it is expedient to consider them in pairs since this ... | 2009 | 17436720 |
| nickel induced histopathological changes in the different tissues of freshwater fish, hypophthalmichthys molitrix (valenciennes). | nickel chloride, heavy metal widely used in industries was investigated in the present study for histopathological studies in silver carp (hypophthalmichthys molitrix). fish were exposed for 10, 20 and 30 days in sublethal concentration of nickel 5.7 mg/l. the histopathological changes were studied in the gill, liver, intestine and kidney of the nickel treated freshwater fish h. molitrix. the nickel showed a tissue specific alteration in the tissues. mucus proliferation, fusion of the gill lamel ... | 2006 | 17436530 |
| effect of dietary supplementation of probiotic and vitamin c on the immune response of indian major carp, labeo rohita (ham.). | the immunostimulatory effect of probiotics and vitamin c has been established in many systems including fish. an investigation was carried out to study the effect of dietary supplementation of a probiotic bacterium "bacillus subtilis", vitamin c in the form of ascorbyl polyphosphate and their combination on the immune response of indian major carp, rohu, (labeo rohita ham.) fingerlings fed for a period of 60 days. the total serum protein and globulin content was significantly higher (p<0.05) in ... | 2007 | 17434319 |
| adenosine does not save the heart of anoxia-tolerant vertebrates during prolonged oxygen deprivation. | despite adenosine being regarded as an important signaling molecule capable of coordinating atp supply and demand during periods of oxygen deprivation in anoxia-intolerant mammals, the importance of adenosinergic cardiovascular control in anoxia-tolerant vertebrates is poorly understood. here, we report on adenosinergic cardiovascular control during normoxia and prolonged (hours to days) oxygen deprivation for three vertebrate species tolerant of severe hypoxia/anoxia, the closely related common ... | 2007 | 17433747 |
| mercury contamination in the vicinity of a derelict chlor-alkali plant part ii: contamination of the aquatic and terrestrial food chain and potential risks to the local population. | this study investigated the environmental impact and level of risk associated with mercury (hg) contamination near a derelict chlor-alkali plant in pavlodar, northern kazakhstan. several species of fish were sampled from the highly polluted lake balkyldak and the nearby river irtysh, to assess the extent of hg bioaccumulation in the aquatic food chain and potential human health risks. a small number of bovine tissue samples, water samples, soil and plant samples from a nearby village were also i ... | 2007 | 17433415 |
| effects of long-term alachlor exposure on hepatic antioxidant defense and detoxifying enzyme activities in crucian carp (carassius auratus). | alachlor has been widely used in agriculture all over the world. it is suggested that it may be a carcinogen and also an environmental estrogen. in this paper, the physiological and biochemical perturbations of crucian carp (carassius auratus) exposed to alachlor at different concentrations over 60 days were investigated. the gonadosomatic index (gsi) and hepatosomatic index (hsi) were measured. the activity of hepatic antioxidant defense and detoxifying enzymes, superoxide dismutase (sod), cata ... | 2007 | 17433409 |
| interspecific and intraspecific interactions in the monogenean communities of fish: a question of study scale? | monogenean communities of fish have generally been considered non-interactive as negative interspecific interactions have rarely been reported. most of the earlier studies on monogenean communities, however, have been conducted not only in systems with relatively low parasite abundances but, more importantly, at study scales where microhabitat-level interactions between the parasites are easily overlooked. we examined the communities of 3 abundant dactylogyrus (monogenea) species on the gills of ... | 2007 | 17428351 |
| persistent chlorinated pesticides in fish species from qiantang river in east china. | thirteen organochlorine pesticides (ocps) in 18 fish species from qiantang river were firstly determined by gc-ecd. to elucidate the sources and the environment fate of these pollutants, water and sediment samples were also analyzed for ocps contents. total concentrations of ocps in fish muscles ranged from 7.43 to 143.79 ng g(-1) wet weight (ww) with highest concentration recorded in sole fish (cynoglossus abbreviatus), a benthic carnivore. the results indicated that carnivore fish have higher ... | 2007 | 17420036 |
| chemical contaminants, health indicators, and reproductive biomarker responses in fish from the colorado river and its tributaries. | common carp (cyprinus carpio), black bass (micropterus spp.), and channel catfish (ictalurus punctatus) were collected from 14 sites in the colorado river basin (crb) to document spatial trends in accumulative contaminants, health indicators, and reproductive biomarkers. organochlorine residues, 2,3,7,8-tetrachlorodibenzo-p-dioxin-like activity (tcdd-eq), and elemental contaminants were measured in composite samples of whole fish, grouped by species and gender, from each site. selenium (se) and ... | 2007 | 17418376 |
| biochemical and ultrastructural changes of the liver and kidney of the phytoplanktivorous silver carp feeding naturally on toxic microcystis blooms in taihu lake, china. | many experimental studies have documented the impact of microcystins (mc) on fish based on either intraperitoneal injection, or oral gavaging via the diet, but few experiments were conducted by mc exposure through natural food uptake in lakes. in this study, the phytoplanktivorous silver carp were stocked in a large pen set in meiliang bay of taihu lake where toxic microcystis blooms occurred in the warm seasons. fish samples were collected monthly and mc concentrations in liver and kidney of th ... | 2007 | 17412382 |
| the effects of heavy metals on common carp white blood cells in vitro. | the in vitro effects of cadmium, copper, lead and zinc, and various cadmium compounds (chloride, sulphate and nitrate) on common carp (cyprinus carpio) lymphocyte viability and phagocyte activity, were evaluated. the percentage of dead lymphocytes was determined after trypan blue staining, and phagocyte activity was measured by using the nitroblue tetrazolium (nbt) reduction test. lead was the most toxic to lymphocytes--the maximum mortality exceeded 30%, and was significantly higher at 1 microm ... | 2007 | 17411356 |
| initial survey of plasma vitellogenin and gonadal development in male carp (cyprinus carpio) from three locations in new jersey, usa. | 2007 | 17410316 | |
| cloning, characterization and promoter analysis of common carp hairy/enhancer-of-split-related gene, her6. | some members of hairy/enhancer-of-split-related gene (hes) family have important effects on axial mesoderm segmentation and the establishment and maintenance of the somite fringe. in fishes, the her6 gene, a member of the hes family, is the homologue of hes1 in mammals and chicken. in this study, the her6 gene and its full-length cdna from the common carp (cyprinus carpio) were isolated and characterized. the genomic sequence of common carp her6 is approximately 1.7 kb, with four exons and three ... | 2006 | 17406090 |
| changes in the level of transaminases in indian major carp, labeo rohita exposed to sublethal concentration of tannery and distillery effluents. | the activity of alanine aminotransferase (alat) and aspartate aminotransferase (aat) of different tissues of fingerlings of labeo rohita under the influence of two effluents has been studied. the alanine aminotransferase activity was increased over the control in different exposed periods of tannery and distillery effluent treatments. the alanine aminotransferase in the liver showed increased activity at different periods than that of the muscle, kidney, gill and brain (p < 0.001) (60.09%) over ... | 2006 | 17402251 |
| hematological and plasma biochemical responses of crucian carp (carassius auratus) to intraperitoneal injection of extracted microcystins with the possible mechanisms of anemia. | alterations in hematological indices such as decreases in blood cell counts (rbc), hematocrit (ht) and hemoglobin (hb) concentrations are key symptoms of anemia. however, few experiments were conducted to examine changes in hematological indices of fish exposed to microcystins that are believed to be fatal to circulatory systems of vertebrates. an acute toxicological experiment was designed to study hematological changes of crucian carp injected intraperitoneally (i.p.) with extracted microcysti ... | 2007 | 17400268 |
| cryopreservation of common carp (cyprinus carpio) sperm in 1.2 and 5 ml straws and occurrence of haploids among larvae produced with cryopreserved sperm. | experiments were carried out on the cryopreservation of common carp (cyprinus carpio) sperm in order to test the suitability of using 1.2 and 5 ml straws and to investigate the ploidy of malformed larvae found among the hatched progeny. in the first set of experiments, the effect of freezing time was investigated on the hatch rate of embryos. the highest hatch rate for 1.2 ml straws was 69+/-16% at the freezing time of 4 min, and 39+/-27% for 5 ml straws at 5 min. in the second set, the effect d ... | 2007 | 17400204 |
| prokaryotic gene profiling assays to detect sediment toxicity: evaluating the ecotoxicological relevance of a cell-based assay. | despite their complexity, ecotoxicological measurements using higher level responses remain a major tool in the assessment of ecosystem integrity. nevertheless, the past decade saw an increasing number of cell based testing systems have found widespread application in ecotoxicology. one such test is bacterial bioreporters carrying a stress sensitive promoter fused to an easily detectable reporter gene. in the presence of a specific toxic stress,the expression cassette is switched on and the repo ... | 2007 | 17396675 |
| [subtelomeric deletion 9qter: definition of the syndrome and parental origin in 2 patients]. | subtelomeric chromosome imbalances are increasingly known as a cause for mental retardation. new phenotypes associated with specific rearrangements are also being delineated, such as 9q microdeletion syndrome. here we define the major phenotypic features and the parental origin of 9q deletion. | 2007 | 17394858 |
| structural and regulatory roles of muscle ankyrin repeat protein family in skeletal muscle. | the biological response of muscle to eccentric contractions (ecs) results in strengthening and protection from further injury. however, the cellular basis for this response remains unclear. previous studies identified the muscle ankyrin repeat protein (marp) family, consisting of cardiac ankyrin repeat protein (carp), ankyrin repeat domain 2/ankyrin repeat protein with pest and proline-rich region (ankrd2/arpp), and diabetes-associated ankyrin repeat protein (darp), as rapidly and specifically u ... | 2007 | 17392382 |
| apolipoprotein a-i, an antimicrobial protein in oncorhynchus mykiss: evaluation of its expression in primary defence barriers and plasma levels in sick and healthy fish. | antimicrobial proteins and peptides play an important role in the primary defence barriers in vertebrates and invertebrates. in a previous study it was shown that high-density lipoprotein (hdl) and its major apolipoproteins, apoa-i and apoa-ii display antimicrobial activity in the carp (cyprinus carpio l.). the aim of this study was to evaluate if apoa-i conserves this defensive function in a salmonid fish like the rainbow trout, in spite of the low level of primary sequence conservation between ... | 2007 | 17391986 |
| the effects of cooking on residues of malachite green and leucomalachite green in carp muscles. | the effects of various cooking methods (boiling, baking and microwaving) on residues of malachite green (mg) and its major metabolite, leucomalachite green (lmg), in incurred carp muscles were investigated. moreover, the stability of mg and lmg standard solutions under boiling in water and in oil was examined. the mg and lmg residues in cooked meat were determined by liquid chromatography with visible and fluorescence detectors. the results showed that in muscles cooked by boiling or baking mg c ... | 2007 | 17386743 |
| efficacy of some anticoccidial drugs for treating coccidial enteritis of the common carp caused by goussia carpelli (apicomplexa: eimeriidae). | in this study, nine anticoccidial drugs commonly used in poultry were tested for efficacy for the prevention and treatment of goussia carpelli (apicomplexa) infection in common carp (cyprinus carpio l.). to establish experimental infection with g. carpelli, paratenic host oligochaetes of the genera tubifex and limnodrilus were infected with oocysts, and laboratory-cultured parasite-free common carp fingerlings were infected by feeding to them oligochaetes containing sporozoites. the anticoccidia ... | 2007 | 17385557 |
| serum antibody response of indian major carp, labeo rohita to three species of pathogenic bacteria; aeromonas hydrophila, edwardsiella tarda and pseudomonas fluorescens. | the immune response to mixed whole cell antigens of aeromonas hydrophila, edwardsiella tarda and pseudomonas fluorescens, the common gram negative bacterial pathogens associated with diseases of indian major carps were evaluated for their efficacy in triggering antibody responses in rohu, labeo rohita (ham.). the rohu yearlings were either immunized with antigens from single bacterial strain, a. hydrophila, e. tarda and p. fluorescens or a combination of all three. an antibody response was detec ... | 2007 | 17383016 |
| effects of polyherbal formulation 'immuplus' on immunity and disease resistance of indian major carp, labeo rohita at different stages of growth. | a series of experiments were performed to determine the impact of polyherbal immunomodulatory formulation 'immuplus' (aquaimmu) on growth, immunity and disease resistance of rohu (labeo rohita), one of the indian major carp at different stages of growth. rohu larvae were fed on plankton, immuplus-mixed compound feed, and plankton plus immuplus-mixed compound feed (immuplus added at three dose levels of 0.25, 0.50, and 0.75 g/kg feed) from 4th day of hatching to 14th day. immuplus-mixed diets enh ... | 2007 | 17373376 |
| [cloning and the sequence analysis of the fish glutathione transferase pi gene]. | using rt-pcr method, the glutathione transferase pi cdnas were cloned from cyprinus carpio, hypophthalmichthys molitrix, and carassius auratus. the open reading frames (orfs) from the 3 fishes were 627 bp long (encoding for 208 amino acids) with the initial code atg and the terminal code tga. the sequence similarity was 50% between fish and mammals, 33% between fish and amphibian, and 15% between fish and arthropoda, respectively. the sequence similarity was big among fishes, and the average val ... | 2007 | 17369158 |
| recent development of anaerobic digestion processes for energy recovery from wastes. | anaerobic digestion leads to the overall gasification of organic wastewaters and wastes, and produces methane and carbon dioxide; this gasification contributes to reducing organic matter and recovering energy from organic carbons. here, we propose three new processes and demonstrate the effectiveness of each process. by using complete anaerobic organic matter removal process (carp), in which diluted wastewaters such as sewage and effluent from a methane fermentation digester were treated under a ... | 2007 | 17368391 |
| the gene structure and expression of the non-specific cytotoxic cell receptor protein (nccrp-1) in atlantic cod (gadus morhua l.). | the non-specific cell receptor protein (nccrp-1) serves an important function in target cell recognition and activation of non-specific cytotoxic cells in teleosts. atlantic cod nccrp-1 was identified in a suppression-subtractive cdna library and nccrp-1 from atlantic salmon, rainbow trout, japanese medaka and fathead minnow was found deposited in the genbank as est sequences. the predicted amino acid sequences of these receptors contain the characteristic functional domains representing nccrp-1 ... | 2007 | 17368063 |
| use of chemical communication in the management of freshwater aquatic species that are vectors of human diseases or are invasive. | chemical communication occurs when both originator (signaller) and one or more receiver(s) possess specializations for chemical exchange of information. chemical information can be used by a wide variety of species to locate food and mates, avoid predators and engage in social interactions. in this review, we focus on chemical signalling between mates or cues from nest sites or hosts by selected aquatic pest species and indicate how chemical information can be used to manage pests. the pests are ... | 2007 | 17367788 |
| estimating the active metabolic rate (amr) in fish based on tail beat frequency (tbf) and body mass. | tail beat frequency (tbf) was measured for carp (cyprinus carpio) and roach (rutilus rutilus), during steady swimming at five different speeds and for fish of various body masses. a multiple stepwise linear regression analysis resulted in models for the prediction of tbfs depending on swimming speed as an independent variable. speed explained 72 and 86% of the variance in tbf for carp and roach, respectively. by using these data to predict tbf from speed and substituting values into a model from ... | 2007 | 17366622 |
| the reserpine effects on the gonadotrophic cells of the male common carp cyprinus carpio (osteichtyes: cyprinidae). | the secretion of gonadotropins (gth) in goldfish and carp, is stimulated by gth-releasing hormone (gnrh) and is inhibited by dopamine. studies with antidopaminergics have demonstrated to be effective in order to stimulate the spermiation and the ovulation in different species of teleosts. the reserpine, a drug that deplets the dopamine, has shown to stimulate the spermiation in the common carp. we report here, the effects of reserpine on the number and volume of gonadotrophic cells of the common ... | 2004 | 17357409 |
| commentary on "the coronary artery revascularization prophylaxis (carp) trial: results and remaining controversies". | 2006 | 17351188 |