Publications
| Title | Abstract | Year Filter | PMID(sorted descending) Filter |
|---|
| live and reactivated motility in the 9+0 flagellum of anguilla sperm. | the sperm flagella of the eel, anguilla anguilla, are capable of vigorous motion in spite of having an axoneme with reduced structure that lacks the outer dynein arms, radial spokes and spoke heads, the two central tubules and the central tubule projections that are all part of the standard "9+2" axoneme. these sperm progress forward rapidly as a result of the propagation of helicoidal waves distally along the flagellum. their flagellar beat frequencies are high, 93 hz at 21 degrees c, and they ... | 1985 | 2931175 |
| ionic and total calcium levels in the blood of the european eel (anguilla anguilla): effects of stanniectomy and hypocalcin replacement therapy. | removal of the corpuscles of stannius (stx) in the freshwater european eel causes a marked increase in the concentrations of blood ionic calcium and protein-bound calcium. the hypercalcaemia peaks 20 days after stx and lasts at least another 20 days. in stanniectomized eels hypocalcin decreased both blood ionic and total calcium concentrations. the reduction of plasma total calcium concentration by hypocalcin is attributed to a reduction in blood ionic calcium concentration. we conclude that hyp ... | 1989 | 2926317 |
| basolateral inositol transport by intestines of carnivorous and herbivorous teleosts. | myoinositol transport by isolated basolateral membrane vesicles was characterized from intestines of the herbivorous tilapia (oreochromis mossambicus) and the carnivorous eel (anguilla anguilla). [3h]myoinositol transport occurred by nonelectrogenic, facilitated diffusion independent of cation gradients and was inhibited by phloretin (ki = 0.6 and 0.9 mm for tilapia and eel, respectively) but not by phloridzin. kinetic analysis of myoinositol influx disclosed no differences in concentration yiel ... | 1989 | 2923212 |
| brush-border inositol transport by intestines of carnivorous and herbivorous teleosts. | transport characteristics of myoinositol by isolated brush-border membrane vesicles of two fish, the herbivorous tilapia (oreochromis mossambicus) and the carnivorous eel (anguilla anguilla), were measured. [3h]myoinositol uptake by vesicles of both fish was stimulated by a transmembrane na gradient, was electrogenic, and was inhibited by phloridzin. kinetic analysis of myoinositol influx disclosed species differences (tilapia, k = 0.15 mm, jmax = 0.2 nmol.mg protein-1.min-1; eel, k = 2.6 mm, jm ... | 1989 | 2923211 |
| ventilatory and circulatory adjustments in the european eel (anguilla anguilla l.) exposed to short term hypoxia. | respiratory and circulatory (measured and calculated) variables were obtained at the same time in resting eels, during normoxia and after 1 h exposure to environmental hypoxia (water po2 of 40 torr). in normoxia, values of respiratory and circulatory variables appeared less than those reported for most other fish. these differences could be partly explained by a lower level of standard metabolism and a greater uptake of o2 through the skin. hypoxia caused a marked decrease in heart rate (40%), c ... | 1989 | 2920810 |
| basolateral amino acid and glucose transport by the intestine of the teleost, anguilla anguilla. | 1. d-glucose transport into blmv was osmotically reactive, sodium independent, and inhibited by phloretin but not by phloridzin. 2. the survey of 6 l-amino acids identified three groups with respect to transfer across the basolateral cell border. transport of proline and glutamate occurred by na-dependent carriers and by apparent simple diffusion. alanine, lysine and phenylalanine were transported by na-independent carriers and apparent simple diffusion. glycine transport was stimulated above ap ... | 1988 | 2907446 |
| regulation of eel (anguilla anguilla) liver acetyl-coa carboxylase by changes in the polymeric state of the enzyme. | 2010 | 2905608 | |
| properties of european eel (anguilla anguilla) liver cell sap acetyl-coa carboxylase. | 2010 | 2905607 | |
| somatostatin-related and glucagon-related peptides with unusual structural features from the european eel (anguilla anguilla). | peptides derived from prosomatostatins i and ii and from two distinct proglucagons have been isolated from the pancreas of a teleost fish, the european eel (anguilla anguilla). the product of prosomatostatin i processing, somatostatin-14, is identical to mammalian somatostatin-14. a 25-amino-acid-residue peptide (ser-val-asp-asn-gln5-gln-gly-arg-glu-arg10-lys-ala-gly-cys- lys15-asn-phe-tyr- trp-lys20-gly-pro-thr-ser-cys25) is derived from prosomatostatin ii. compared with the corresponding pepti ... | 1988 | 2904391 |
| the effect of pressure on the lateral swimming muscle of the european eel anguilla anguilla and the deep sea eel histiobranchus bathybius; results of challenger cruise 6b/85. | 1. the viability of histiobranchus lateral muscle was prolonged up to 7 times by recompression of the tissue. 2. the maximum twitch contraction force of both anguilla and histiobranchus was recorded at a pressure between 150 and 350 atm. at 1 atm anguilla developed 60% maximum force and histiobranchus 10-20% maximum force. 3. twitch contraction time doubled for a pressure increase of 400 atm. this effect is predicted to halve the maximum swimming speed at 4000 m and is discussed in relation to m ... | 1987 | 2892634 |
| effects of hydrostatic pressure on the motor activity of fish from shallow water and 900 m depths; some results of challenger cruise 6b/85. | 1. two species of benthic fish from 900 m depths (90 atm pressure), trachyscorpia cristulata echinata and synaphobranchus kaupi, are shown to be adapted to their normal, high ambient pressure. 2. their condition improves when they are restored to their normal pressure after experiencing decompression in a trawl and they undergo convulsions at 150 atm. 3. this contrasts with the response of shallow water species (salmo salar, pleuronectes platessa, anguilla anguilla and gadus morhua) which convul ... | 1987 | 2892630 |
| effect of dietary carbohydrate source on soluble protein glucose concentration and enzyme activity (aldolase) of european eels (anguilla anguilla l.). | this study was undertaken to determine the influence of dietary carbohydrate sources: wheat meal, bread meal, soluble corn starch, native potato starch and sorghum meal, on soluble protein, enzyme activity (aldolase) and glucose concentration in muscle and liver of european eels (anguilla anguilla). there was less soluble protein in both muscle and liver of eels fed 30% wheat meal or bread meal than the other experimental groups. however, eels fed 30% bread meal or soluble corn starch had a high ... | 1987 | 2886257 |
| the relationship of eel anguilla anguilla (l.) body size, lipid, protein, glucose, ash, moisture composition and enzyme activity (aldolase). | body composition: protein, lipid, ash, moisture; and enzyme activity (aldolase) were studied in european eels (anguilla anguilla) of various sizes. the fish were brought to the laboratory as glass eels (0.35 g) and maintained under controlled conditions (23 degrees c) for one year. after one year of growth, various sizes (between 9 and 420 g) were found. significant correlation coefficients of the equation w = a ln c + b (where w = body weight, in g; c = composition, % or activity, u; and a,b ar ... | 1986 | 2875842 |
| suppression of plasma thyroid hormone concentrations by cortisol in the european eel anguilla anguilla. | female european eels, anguilla anguilla, were given a single intra-arterial injection via a catheter of cortisol hemisuccinate at doses ranging from 3.5 to 35 micrograms (15 to 150 micrograms/kg body wt), yielding mean plasma cortisol levels of 87-410 ng/ml 2 hr after injection. cortisol treatment (17.5 and 35 micrograms) significantly decreased plasma levels of thyroxine (t4) and triiodothyronine (t3) within 24 hr relative to those in control fish. cortisol treatment (35 micrograms) appeared to ... | 1986 | 2870843 |
| detection of endocrine cells by immunofluorescence method in the gastroenteropancreatic system of the adult eel, glass-eel, and leptocephalic larva (anguilla anguilla l.). | five antisera against insulin (ins), glucagon (glu), somatostatin (srif), met-enkephalin (met-enk), and serotonin (5-ht) were used for immunofluorescence detection of endocrine cells in pancreas and gastrointestinal tract (git) of the european eel (anguilla anguilla l.) at three stages of development (leptocephalic larva, glass-eel, and adult eel). comparable distribution of endocrine cells was observed for adults and glass-eels. in their pancreatic islets, positive immunoreactions were obtained ... | 1985 | 2861142 |
| seasonal variations in hematocrit, red cell hemoglobin and nucleoside triphosphate concentrations, in the european eel anguilla anguilla. | eels acclimatized in nature show a significant annual variation in erythrocytic guanosine triphosphate (gtp) concentration, temperature range 0.5-17 degrees c. a similar but smaller annual variation is also present in eels acclimated in the laboratory at constant temperature, 17 degrees c. hematocrit and blood oxygen capacity showed no seasonal variation. natural minimal and maximal red cell gtp concentrations were found at the end of the dormancy period (march) and in the late summer, respectiv ... | 1985 | 2859960 |
| temperature acclimation and oxygen binding properties of blood of the european eel, anguilla anguilla. | temperature acclimation of the european eel, anguilla anguilla, resulted in red cell gtp/hb molar ratios of 1.20, 1.77 and 0.80 at 2, 17 and 29 degrees c, respectively. a small increase in blood oxygen capacity was present in 29 degrees c acclimated eels. the co2 bohr effect and the shape of the oxygen binding curve (n-hill) were invariant with both temperature and gtp/hb. the significant differences in the gtp/hb ratio corresponded with a strong enhancement of the temperature effect on blood ox ... | 2006 | 2859959 |
| water and lactate movement in the swimbladder of the eel, anguilla anguilla. | hemoglobin (hb) and lactate (la) concentrations were measured in small (150 microliters) blood samples collected with micropipettes from the inflow and outflow vessels of the rete mirabile of the eel swimbladder. hemoglobin was used as a marker of the intravascular space. 1. hemoglobin concentrations suggest that there was no significant water movement between the arterial and venous capillaries in the rete, but a significant 6% water efflux from the vascular space into the swimbladder epitheliu ... | 1989 | 2813987 |
| triiodothyronine binding to putative solubilized nuclear thyroid hormone receptor in liver and gill of the brown trout (salmo trutta) and the european eel (anguilla anguilla). | the binding of 3,5,3'-triiodothyronine (t3) to salt-extracted nuclear protein of liver and gill from trout and eel was studied in vitro. [125i]t3 binding depended on the temperature and protein concentration. binding equilibria were achieved in the two tissues of each species between 15 and 24 hr at 4 degrees. the binding was reversible in the presence of excess unlabeled t3. scatchard analysis showed a single class of high affinity and low capacity t3 binding species considered, 2.71 x 10(-10) ... | 1989 | 2806877 |
| immunocytochemical analysis of the dopamine system in the brain and spinal cord of the european eel, anguilla anguilla. | the distribution of dopamine-containing perikarya and fibres in the central nervous system of the eel, anguilla anguilla, was determined by using a specific dopamine antiserum. telencephalic dopamine-immunoreactive somata are located in the external cell layer of the olfactory bulb and throughout the rostrocaudal extent of the subpallium; immunoreactive fibres are located primarily in the bulb and in ventral and lateral portions of the hemispheres. diencephalic dopamine-immunoreactive neurons ar ... | 1989 | 2802190 |
| brush-border amino acid transport mechanisms in carnivorous eel intestine. | brush-border membrane vesicles (bbmv) were prepared from european eel (anguilla anguilla) intestinal epithelium by a magnesium-ethylene glycolbis(beta-aminoethyl ether)-n,n,n',n'-tetraacetic acid (egta) precipitation technique. amino acid transport by these purified vesicle preparations was investigated using either radiolabeled substrates or the voltage-sensitive fluorescent dye 3,3'-diethylthiadicarbocyanine iodide [disc2(5)]. all amino acids tested exhibited carrier-mediated, na+-dependent an ... | 2009 | 2782453 |
| isolation and primary structure of the c-peptide of proinsulin from the european eel (anguilla anguilla). | 1. the primary structure of the c-peptide of proinsulin from the european eel has been established as: dvepllgflspksgqenevddfpykgqgel. the peptide was isolated from the extract of eel pancreas in a yield that was approximately equimolar with insulin. a comparison with the predicted structures of c-peptides from other teleost fishes has identified a domain in the central region of the peptide that has been more highly conserved than the rest of the molecule. | 1989 | 2776429 |
| how many na+-dependent carriers for l-alanine and l-proline in the eel intestine? studies with brush-border membrane vesicles. | using brush-border membrane (bbm) vesicles prepared from the intestine of the european eel, the specificity of l-alanine and l-proline na+-dependent transport was investigated by measuring the uptake of isotopically labelled substrates. in the presence of na+ ions, cross-inhibition between alanine and proline transports was observed; in addition alpha-(methylamino)isobutyric acid (meaib) inhibited proline but had no effect on alanine uptake. these results can be explained by the presence, in eel ... | 1989 | 2765548 |
| cupula displacement, hair bundle deflection, and physiological responses in the transparent semicircular canal of young eel. | the transparent labyrinth of young eels (anguilla anguilla l.) was used in toto for studying the configuration of cupula displacement, deflection of the hair bundle, and correlated changes in transepithelial voltage (delta tev) and nerve activity (delta na) in the semicircular canal. microcapillaries were introduced into the canal through holes produced by a microthermocauter. mechanical stimulation was applied either by injection of fluid into the ampulla or by electromagnetically displacing fe ... | 1989 | 2740206 |
| effects of vertebrate prolactins and growth hormones on thyroxine 5'-monodeiodination in the eel (anguilla anguilla): a potential bioassay for growth hormone. | growth hormones (ghs) and prolactins (prls) purified from representatives of each vertebrate class from bony fish onwards were tested for their ability to stimulate in vivo peripheral deiodination of labeled thyroxine (t4*) into triiodo-l-thyronine (t3*) in the eel. plasma t3*/t4* ratio was used as parameter. all ghs significantly increased t3*/t4*, the magnitude of the response being unrelated to the phylogenic position of species. no significant stimulation was shown with the various prl, with ... | 1989 | 2707580 |
| effects of long-term exposure to hydrostatic pressure per se (101 ata) on eel metabolism. | oxygen consumption, mo2, has been measured in yellow freshwater eels (anguilla anguilla l.) exposed in normoxic conditions for 31 days at a hydrostatic pressure of 101 ata (atmosphere absolute; 1 ata = 0.1 mpa) using a high pressure water circulation system. the results (series i) show that from a maximal value observed at the end of compression, mo2 decreases exponentially with time (tau congruent to 1.4 days) then reaches a steady state (mo2 = 0.67 +/- 0.05 mmol.h-1.kg-1) at a lower level than ... | 1989 | 2611722 |
| partial purification of parathyrin from the corpuscles of stannius (pcs) of the eel (anguilla anguilla, l.). | it has been previously shown that the eel corpuscles of stannius (cs) synthesize and secrete a substance (pcs) which is functionally and immunologically related to the mammalian parathyrin family. purification of pcs, including anion-exchange chromatography, ods c-18 reverse-phase hplc, and affinity chromatography, showed that a biologically active peak, eluted in 32% acetonitrile, contains a 32- to 34-kda protein which is 600-fold more potent than the crude extract is a test involving the hypoc ... | 1989 | 2599351 |
| na-dependent l-glutamate transport by eel intestinal bbmv: role of k+ and cl-. | l-[3h]glutamate uptake into eel (anguilla anguilla) intestinal brush-border membrane vesicles (bbmv) was a sigmoidal function of extravesicular na, suggesting that two or more cations accompanied the amino acid during transport. l-[3h]glutamate influx illustrated the following kinetic constants: apparent membrane binding affinity (kapp) = 0.80 +/- 0.12 mm; influx velocity (jmax) = 2.61 +/- 0.31 nmol.mg protein-1.min-1; and permeability coefficient (p) = 0.65 +/- 0.10 microliters.mg protein-1. mi ... | 1989 | 2568760 |
| solute back-diffusion raises the gas concentrating efficiency in counter-current flow. | we have extended the counter-current model of the rete mirabile of the fish swimbladder to include the effects of inert gas secretion into the swimbladder as well as solute back-diffusion in the rete capillaries. (1) gas secretion attenuates the inert gas concentrating efficiency of the rete, i.e. its ability to produce high inert gas partial pressures in blood at the swimbladder pole. the maximum attainable gas secretion rate depends on the salting-out effect, i.e. on the ratio of solubility in ... | 1989 | 2554452 |
| saccharide residues in human gingiva as revealed with fluorochrome-coupled lectins. | the histochemical binding of 16 fluorochrome-conjugated lectins to human marginal gingiva was investigated. of a total of 14 galactose/n-acetylgalactosamine (gal/galnac)-specific lectins, dolichos biflorus (dba), helix pomatia (hpa), and helix aspersa agglutinins (haa) were blood group a-reactive whereas griffonia simplicifolia i-b4 (gsa-i-b4) and sophora japonica (sja) agglutinins were blood group b-reactive. hpa, haa and gsa-i-b4 bound to all suprabasal epithelial cells and to vascular endothe ... | 1989 | 2542513 |
| distribution and pharmacological properties of the gabaa/benzodiazepine/chloride ionophore receptor complex in the brain of the fish anguilla anguilla. | in the present study, we characterized the distribution and the pharmacological properties of the different components of the gabaa receptor complex in the brain of the eel (anguilla anguilla). benzodiazepine recognition sites labeled "in vitro" with [3h]flunitrazepam ([3h]fnt) were present in highest concentration in the optic lobe and in lowest concentration in the medulla oblongata and spinal cord. a similar distribution was observed in the density of gamma-[3h]aminobutyric acid ([3h]gaba) bi ... | 1989 | 2538558 |
| microhabitats of monogenean gill parasites on european eel (anguilla anguilla). | the distribution of adult pseudodactylogyrus anquillae and p. bini and postlarvae was recorded on glass-eels and pigmented eels of different size and infection intensity. the two species occupied different microhabitats on the host's gill apparatus but the preferred sites depended partly on host size. postlarval migration was indicated. mortality of young parasites, reinforcement of reproductive barriers and competition seems to be less likely explanations of the spatial distribution. | 1989 | 2488048 |
| influence of protein content of diet on growth and lipid composition of european eel muscle and liver. | the influence of diet protein content (35-45-55%) on growth and lipid composition of muscle and liver of european eel (anguilla anguilla) was studied for the first time. in control eel, triacylglycerols constituted about 90% of total lipids in muscle and about 40% in liver. triacylglycerol content in eel muscle significantly increased after two months of treatment with any diet assayed, with independence of protein content and source. in liver, this increase was comparatively higher in herring m ... | 1989 | 2475082 |
| lethal toxicity of lindane on a teleost fish, anguilla anguilla from albufera lake (spain): hardness and temperature effects. | this paper reports the results of toxicity tests conducted using anguilla anguilla under three different water temperature (15, 22 and 29 degrees c) and two hardness regimes (250 and greater than 600 ppm caco3). the 96-h lc50 increased in the experimental medium (p less than 0.05) by an order of magnitude from 0.32 to 0.45 mg/l between 15 and 29 degrees c. however in the natural medium it is similar (p greater than 0.05) (0.54 to 0.55 mg/l) for these same temperatures. the toxicity of lindane on ... | 1988 | 2453551 |
| distribution of afferent fibers in the brainstem from end organs in the ear and lateral line in the european eel. | sensory nerve fibers from the lateral line system and labyrinth of anguilla anguilla were labeled with horseradish peroxidase and traced to various targets in the ipsilateral brainstem. the three rami of the anterior lateral line nerve and the supratemporal ramus of the posterior lateral line nerve form overlapping terminal zones in the ventral portion of nucleus medialis. the posterior lateral line nerve on the body is represented exclusively in the dorsal half of the nucleus medialis. eighth n ... | 1987 | 2448347 |
| distribution and morphological characteristics of efferent neurons innervating end organs in the ear and lateral line of the european eel. | neurons that provide the efferent innervation to the labyrinthine and lateral line sense organs of the eel were located by applying horseradish peroxidase to branches of the appropriate cranial nerves. retrogradely labeled neurons were found in a single median column, the octavolateralis efferent nucleus (oen), located immediately rostral to and overlapping with the facial nucleus of the branchiomotor column. we estimate that on each side of the brain the efferent nucleus contains about 60-70 ne ... | 1987 | 2448346 |
| acute toxicity of organochlorined pesticides to the european eel, anguilla anguilla: the dependency on exposure time and temperature. | 1987 | 2444293 | |
| localization of beta-hydroxysteroid dehydrogenase in anguilla anguilla testis. | the histochemical reaction for 3 beta-hydroxysteroid dehydrogenase was applied to glutaraldehyde fixed eel testis and successively processed for transmission electron microscopy. the reaction product was found only on the smooth endoplasmic reticulum and in the intermembrane space of mitochondria of the leydig cells of hcg treated silver eels. the positive cytochemical reaction appears to be coupled with an enlargement of the leydig cells and an increase of their smooth endoplasmic reticulum. | 1987 | 2443116 |
| estradiol has inverse effects on pituitary glycoprotein hormone alpha-subunit messenger ribonucleic acid in the immature european eel and the gonadectomized rat. | in teleosts, the pituitary contains a single glycoprotein gonadotropic hormone (gth) composed of two dissimilar alpha- and beta-subunits. the european eel, anguilla anguilla l, is sexually immature at the silver stage due to a deficiency in gth synthesis and secretion. in previous studies we (s.d., ya.f.) have demonstrated a strong stimulatory action of estradiol (e2) on eel pituitary gth content. in contrast, we (r.c., m.j.) have shown that in the rat e2 negatively regulates gonadotropin subuni ... | 1987 | 2441980 |
| on the heterogeneity of purkinje neurons in vertebrates. cytochemical and morphological studies of chromatin during eel (anguilla anguilla l.) life cycle. | the relationship between the heterogeneity of purkinje cell chromatin and the functional involvement of cerebellum has been analyzed comparing two stages of eel life cycle (yellow eel and silver eel) which are characterized by a different degree of swimming activity. the dna content and the chromatin condensation have been studied by means of microdensitometry (feulgen-dna, feulgen-dna/area), microfluorometry (dna after intercalation with propidium iodide at low and high concentration) and elect ... | 1985 | 2410490 |
| the na(+)-dependent proline carrier, of eel intestinal brush-border membrane, sequentially binds proline and then na+. | the mechanism of na+/l-proline cotransport, present on brush-border membrane (bbm) vesicles of the european eel intestine, was studied. initial cotransport rates, depending on increasing proline and na+ concentrations in the extravesicular medium (zero-trans conditions), were measured by monitoring the decay of an inside-negative membrane potential, i.e. the fluorescence quenching of the voltage-sensitive cyanine dye 3,3'-diethylthiacarbocyanine iodide (dis-c2(5)). by simultaneously estimating t ... | 1990 | 2397223 |
| [regional and recent trends in the chlorinated hydrocarbon levels in eels from berlin waters]. | during the five year period from early 1982 to 1986, we engaged in research concerning the chlorinated hydrocarbon content of eels (anguilla anguilla l.) in the limnic water ecosystem of berlin (west). the total count of analytical samples, taken at 11 different sampling points, comprised 370 samples, divided up into 41 collectives. each fish was checked individually for the patterns of contamination with chlorinated hydrocarbons, especially ddt-, bhc-, and pcb-related compounds. the various are ... | 1990 | 2353916 |
| [hormonal stimulation, in vivo, of the ovary of european eel in the yellow stage]. | the immature ovary of yellow eel was stimulated by a long-term treatment with a gonadotropin ii rich extract of carp pituitary. ovarian follicles of treated yellow eels showed an accumulation of lipidic vacuoles in the oocyte cytoplasm and a thickened follicular envelope (in this regard, they resembled the ovarian follicles of previously studied silver eels). the treatment also resulted in a significant but limited increase in the gonadosomatic ratio and mean follicle size (these values were muc ... | 1990 | 2291806 |
| myosin structure in the eel (anguilla anguilla l.). demonstration of three heavy chains in adult lateral muscle. | myosin extracts from central white fibers and peripheral red fibers of the lateral muscle of eel (anguilla anguilla) were analysed by electrophoresis under non-dissociating conditions, which demonstrated a polymorphism of myosin isoforms. the light and heavy subunit content of the isomyosins was established using sds-page and two-dimensional electrophoresis. in the central white muscle, 3 myosin isoforms fm3, fm2, fm1, were characterized by 3 types of fast light chain and one fast heavy chain hc ... | 1990 | 2269355 |
| an experimental study of the retinal projections of the european eel (anguilla anguilla), carried out at the catadromic migratory silver stage. | a radioautographic study of the european eel (anguilla anguilla) was carried out in ten female specimens at the catadromic migratory silver stage. terminal arborizations of contralaterally projecting visual fibres were identified in ten hypothalamic structures (area optica preoptica ventralis and the nuclei suprachiasmaticus, opticus hypothalamicus ventromedialis, preopticus magnocellularis lateralis, posterioris lateralis, posterioris dorsalis periventricularis posterioris dorsalis lateralis, p ... | 1990 | 2254656 |
| influence of inorganic lead on the biochemical blood composition of the eel, anguilla anguilla l. | yellow eels (anguilla anguilla l.) with an average weight of 50 g were caught in september in the aveiro lagoon on the portuguese west coast and kept in aerated aquaria for 1 week before the experiment started. the eels were exposed to an inorganic lead concentration of 300 micrograms pb/liter for 30 days. differential white blood cell count showed an increase in the number of lymphocytes in exposed fish. blood hemoglobin and number of red blood cells per cubic millimeter showed no differences b ... | 1990 | 2226244 |
| metabolic effects of kraft mill effluents on the eel anguilla anguilla l. | yellow eels (anguilla anguilla l.) with an average weight of 60 g were used in this experiment. the fish were caught in june/july at the aveiro lagoon on the portuguese west coast, transported to the department of biology, aveiro university, and kept in aerated aquaria for 1 week before the experiment started. the eels were then exposed for 1 and 3 weeks to 75 and 50% of the kraft pulp mill effluent. the eels exposed to the kraft pulp mill effluent developed an increase in red blood cell number ... | 1990 | 2226239 |
| chromatographic and immunological evidence for mammalian gnrh and chicken gnrh ii in eel (anguilla anguilla) brain and pituitary. | gonadotropin-releasing hormone (gnrh) peptides in the brain and pituitary of the european eel (anguilla anguilla) were investigated by reverse phase high performance liquid chromatography (hplc) and radioimmunoassay with region-specific antisera. two gnrh molecular forms were demonstrated in brain and pituitary extracts. one form eluted in the same position as synthetic mammalian gnrh on hplc and was recognized by antibodies directed against the nh2 and cooh termini of mammalian gnrh as well as ... | 1990 | 2199948 |
| lysine transport by brush-border membrane vesicles of eel intestine: interaction with neutral amino acids. | l-[3h]lysine uptake was measured in brush-border membrane vesicles prepared from intestinal mucosa of the european eel anguilla anguilla. lysine uptake occurred via 1) a nonsaturable component with an apparent diffusional permeability (p) of 0.58 microliter.mg protein-1.min-1,2) a na-dependent transport system [half-saturation constant (kapp) 0.16 mm, maximal transport rate (jmax) 3.57 nmol.mg protein-1.min-1]; 3) a na-independent transport system (kapp 0.17 mm, jmax 2.77 nmol.mg protein-1.min-1 ... | 1990 | 2124427 |
| molecular cloning and sequence analysis of the cdna for the putative beta subunit of the type-ii gonadotrophin from the european eel. | oestradiol treatment enhances type-ii gonadotrophin (gth-ii) synthesis in the european eel (anguilla anguilla) at the silver stage. as a first step in studying the molecular mechanisms involved in this stimulation, we cloned and characterized the cdna encoding the beta subunit of eel gth-ii. a cdna library was constituted in lambda gt10 from oestradiol-treated eels. it was screened using an oligodeoxyribonucleotide mixed probe designed to be complementary to a highly conserved region of cdnas fr ... | 1990 | 2116136 |
| co2 back-diffusion in the rete aids o2 secretion in the swimbladder of the eel. | in order to estimate the relative importance of back-diffusion of o2 and co2 for their partial pressure enhancement in the swimbladder, we have determined o2 and co2 partial pressure and content and ph in microsamples collected non-obstructively from the afferent and efferent rete vessels in the european eel. 1. the po2 increased significantly along the arterial vessels of the rete (from 33 to 303 torr), with no change in o2 content, suggesting o2 not to be exchanged in the rete counter-current ... | 1990 | 2113304 |
| induction of biotransformation in the liver of eel (anguilla anguilla l.) by sublethal exposure to dinitro-o-cresol: an ultrastructural and biochemical study. | structural and functional alterations in hepatocytes of the european eel, anguilla anguilla, following a 4-week-exposure to 5, 50, and 250 micrograms/liter dinitro-o-cresol (dnoc) were investigated by means of electron microscopy and biochemistry and compared to liver pathology in eels exposed to the chemical spill into the rhine river at basle in november 1986. whereas phenological parameters (growth, condition factor) are unaffected, ultrastructural and biochemical alterations are detectable a ... | 1991 | 2065626 |
| effects of hyperbaric pressure and temperature on atria from ectotherm animals (rana pipiens and anguilla anguilla). | 1. spontaneously beating atria from frogs (r. pipiens) and eels (a. anguilla) were compressed hydraulically to 10 mpa. effects on beating frequency and twitch tension were studied. 2. at low temperatures (8-10 degrees c) compression to 10 mpa caused a slowing of the beat frequency. no effects were noted at higher temperatures (16-24 degrees c). twitch tension was decreased by pressure at low temperatures and increased at high temperatures. 3. differences were noted between preparations from cold ... | 1990 | 1968818 |
| [purification and characterization of presumed thyrotropic hormone subunits of a teleost fish, the eel (anguilla anguilla)]. | we have only a partial knowledge of fish thyrotropins (tsh) and no data about peptide sequence are available. various hplc techniques allowed us to purify a 31.4 kda, heterodimeric protein from saline eel pituitary extracts containing tsh activity. partial n-terminal sequence (24 amino acids) from one subunit was strictly identical to that of eel gonadotropin ii (gth ii) alpha subunit. with regard to the second subunit, 41% of the 22 amino acids identified at the n-terminus were homologous to th ... | 1991 | 1933511 |
| regulation of the type-ii gonadotrophin alpha and beta subunit mrnas by oestradiol and testosterone in the european eel. | the gonadotrophic function of the european eel (anguilla anguilla l.) at the silver stage is very weak: gonadotrophin-releasing hormone (gnrh) secretion is deficient and, moreover, dopamine inhibition overrides gnrh action. at the silver stage, oestradiol stimulates the biosynthesis of the type-ii gonadotrophin (gth-ii). to study the molecular mechanism of this activation further, we examined the effect of testosterone and oestradiol administration on pituitary levels of mrna encoding gth-ii alp ... | 1991 | 1892544 |
| the primary structure of glucagon-like peptide but not insulin has been conserved between the american eel, anguilla rostrata and the european eel, anguilla anguilla. | insulin was isolated from the pancreas of the american eel, anguilla rostrata, and its primary structure was established as (formula: see text). eel insulin contains unusual substitutions at b-21, b-22, and b-26 in the putative receptor-binding region of the molecule compared with other mammalian and fish insulins. the a-chain of insulin from the european eel contains an asparagine rather than a serine residue at position a-12. similarly, amino acid composition data indicate the b-chain of insul ... | 1991 | 1874385 |
| potential interactions between acanthocephalus anguillae and pomphorhynchus laevis in their natural hosts chub, leuciscus cephalus and the european eel, anguilla anguilla. | chub and eels were experimentally infected via intermediate hosts harbouring cystacanths, with pomphorhynchus laevis alone, or acanthocephalus anguillae alone, or simultaneously with mixtures of both species in varying proportions, and sampled at 7, 56 or 112 days post-infection. examination of chub revealed that both species showed low establishment and growth rates, differing markedly from british field data, where chub is apparently one of the most important hosts, and preventing further mean ... | 1991 | 1852495 |
| occurrence of acanthocephalus clavula (acanthocephala) in echinogammarus pungens (amphipoda) from the river adige. | cystacanths of acanthocephalus clavula dujardin 1845 (acanthocephala) were found in the hemocoels of naturally infected echinogrammarus pungens m. edwards 1840 (amphipoda). crustaceans were collected in porto frossone, an estuarine locality of the river adige. only 3 out of 562 e. pungens specimens were infected by a. clavula cystacanths; the larvae were enclosed in a thin acellular envelope. infected amphipods were all females, and their total length was greater than that of uninfected females. ... | 1991 | 1844501 |
| in vitro study on the impact of fish sera on the survival and fine structure of the eel-pathogenic acanthocephalan paratenuisentis ambiguus. | the effects of fish sera on the growth and fine structure of infective larvae of the eel-pathogenic acanthocephalan paratenuisentis ambiguus (eoacanthocephala: tenuisentidae) were studied under in vitro conditions using sera from the final host anguilla anguilla and from two accidental fish hosts as well as fetal calf serum. as controls larvae were also kept in medium in the absence of serum and in experimentally infected eels. sera from the accidental fish hosts carp and rainbow trout exerted t ... | 1991 | 1805215 |
| prostaglandins in the kidney, urinary bladder and gills of the rainbow trout and european eel adapted to fresh water and seawater. | prostaglandins in kidney, gills, and urinary bladder of freshwater-adapted and seawater-adapted rainbow trout, oncorhynchus mykiss (= salmo gairdneri), and european eel, anguilla anguilla, were determined by solid-phase extraction of tissue homogenates and high-pressure liquid chromatography. prostaglandins e2, e1, f1 alpha, f2 alpha, and d2 and the more stable metabolite of prostacyclin, 6-keto f1 alpha, occurred in these osmoregulatory tissues. in gill filaments and kidneys of both eel and tro ... | 1991 | 1783277 |
| effects of 17 beta-estradiol and carp gonadotropin on vitellogenesis in normal and hypophysectomized european silver female eel (anguilla anguilla l.) employing a homologous radioimmunoassay for vitellogenin. | the european silver eels are at the early stages of vitellogenesis before the marine reproductive migration. vitellogenesis was induced by 17 beta-estradiol (e2) alone and by a purified carp gonadotropin (cgth). we studied and compared their effects on plasma vitellogenin (vg) levels and ovarian yolk contents in female normal (n) and hypophysectomized (h) eels for both treatments. to this purpose an homologous radioimmunoassay (ria) was established. eel vg was purified to homogeneity on 0.1% sds ... | 1991 | 1783271 |
| regulation of secretion of the teleost fish hormone stanniocalcin: effects of extracellular calcium. | the release in vivo and in vitro of stanniocalcin (stc) from the corpuscles of stannius (cs) of the rainbow trout and the european eel was studied. intraperitoneal injection of cacl2 (2.45 mmol.kg-1 fish) leads to an elevation of both ionic and total calcium in the plasma and results in the release of stc from the cs into the blood. release of stc in vitro is not affected at "physiological" (1.0-1.5 mm) or lower ca2+ levels in the incubation medium. high levels of ca2+ (2.5 mm and higher), howev ... | 1991 | 1778405 |
| in vivo and in vitro toxicity of fractionated fish lipids, with particular regard to their content of chlorinated organic compounds. | six different lipid matrices (the intact lipid (il), four lipid fractions with different polarity, and the free fatty acids (ffas) obtained by hydrolysis of the triacylglycerol (tag) containing fraction) were obtained from salmon (salmo salar) and eel (anguilla anguilla), each collected at a contaminated and a comparatively uncontaminated catch site along the coast of scandinavia. the lipid matrices were studied in toxicological test systems representing various biological functions of different ... | 1991 | 1766922 |
| histochemical, connectional and cytoarchitectonic evidence for a secondary reduction of the pretectum in the european eel, anguilla anguilla: a case of parallel evolution. | there are at least three different patterns of pretectal organization in teleost fishes: a simple pattern observed in cyprinids, an elaborate pattern present in percomorphs, and an intermediately complex pattern seen in many other teleost groups. the taxonomic distribution of the pretectal patterns indicates that the simple and the elaborate patterns are both evolutionarily derived (apomorphic) from the primitive (plesiomorphic) intermediately complex one. in anguillids, the pretectal pattern ob ... | 1991 | 1764633 |
| regeneration of lateral line and inner ear vestibular cells. | labelling experiments with [3h]thymidine demonstrate a continuous production of cells in the mechanoreceptive lateral line organs of the eel (anguilla anguilla) and butterfly fish (pantodon buchholzi) as well as in the electroreceptive ampullary organ of the transparent catfish (kryptopterus bicirrhus). shortly after [3h]thymidine injection many cells are labelled in the middle and basal parts of the sensory organ and after a few days' survival sensory cells are also labelled. the vestibular sen ... | 1991 | 1752161 |
| comparative acute toxicities of selected pesticides to anguilla anguilla. | the acute toxicities (24, 48, 72 and 96 hr) of eight pesticides to anguilla anguilla were determined. the organochlorine pesticide, endosulfan was the most toxic, with lc50 values in the range of 0.042 to 0.041 mg/l. endosulfan was followed in order of decreasing toxicity by diazinon, fenitrothion, chlorpyrifos, lindane, methidathion, trichlorfon and methylparathion. when fishes were exposed to the pesticides tested they exhibited signs of restlessness, erratic swimming, convulsions and difficul ... | 1991 | 1723417 |
| changes in selected biochemical parameters in the brain of the fish, anguilla anguilla (l.), exposed to lindane. | 1991 | 1722731 | |
| effects of lindane on fish carbohydrate metabolism. | exposure of the european eel (anguilla anguilla) to a high sublethal concentration of 0.335 ppm (0.50 of the 96-hr lc50) of lindane for 6, 12, 24, 48, 72, and 96 hr affected carbohydrate metabolism. muscle glycogen levels decreased significantly (p less than 0.05) at 6, 12, 24, 48, 72, and 96 hr; liver glycogen content did not decline at any time. muscle glucose levels in fish were elevated at 6, 12, 24, 48, 72, and 96 hr but in liver, the levels increased only at 96 hr. mean values of muscle an ... | 1991 | 1717227 |
| galanin-like immunoreactivity in the brain of teleosts: distribution and relation to substance p, vasotocin, and isotocin in the atlantic salmon (salmo salar). | the presence of galanin-like substances and their relation to substance p-, vasotocin-, and isotocin-immunoreactive neurons and fibers in the brain of teleosts was investigated with immunohistochemical methods. two specific antisera against synthetic porcine galanin (gal) revealed cell bodies and fibers in the brain of four different teleost species (salmo salar, carassius carassius, gasterosteus aculeatus, and anguilla anguilla). in all four species the main location of galanin immunoreactivity ... | 1980 | 1713923 |
| the effect of time on physiological changes in eel anguilla anguilla, induced by lindane. | 1. eel were exposed to a sublethal concentration of lindane (0.335 ppm) for 6, 12, 24, 48, 72 and 96 hr. 2. concentrations of glycogen, glucose, lactate, pyruvate and lipids were determined in gill tissue after lindane exposure. 3. gill glycogen decreased and glucose levels increased at 6 hr of treatment, lactate and pyruvate concentration increased between 6 and 48 hr. total lipid values decreased between 6 and 24 hr; thereafter, the levels increased up to 72 hr of exposure. 4. clear changes we ... | 1991 | 1713818 |
| difference in the ability of blood group-specific lectins and monoclonal antibodies to recognize the abh antigens in human tissues. | twelve different kinds of blood group-specific lectins have been used along with monoclonal anti-a, -b and -h antibodies for detecting the corresponding antigens in selected human tissues. although most of the lectins recognized the antigens in the tissue sections examined, they displayed marked differences in their recognition patterns in certain tissues. helix asparsa agglutinin (haa), helix pomatia agglutinin (hpa) and monoclonal anti-a antibody recognized a antigens in the mucous cells of sa ... | 1990 | 1705925 |
| characterization of pore-forming activity in liver mitochondria from anguilla anguilla. two porins in mitochondria? | a fast purification procedure for the isolation and purification of eukaryotic porin (de pinto et al., (1987) biochim. biophys. acta 905, 499-502) was applied to liver mitochondria of the fish anguilla anguilla. a protein preparation was obtained which formed slightly anionically selective pores in reconstitution experiments with lipid bilayer membranes. the distribution of single-channel conductances had two maxima of 2.4 ns and 4.0 ns in 1 m kcl. sodium dodecylsulfate electrophoretograms of th ... | 1991 | 1705440 |
| cloning and sequence analysis of the cdna for the pituitary glycoprotein hormone alpha-subunit of the european eel. | a cdna library constructed using mrnas isolated from pituitary glands of estradiol-treated eels was screened with a cdna fragment for the rat glycoprotein hormone alpha-subunit. three out of 10,000 cdna clones were revealed and subcloned in puc13 for characterization and sequencing. all three had the same nucleotide sequence except for a single, silent change in the coding sequence for one of them, and for the location of the poly(a) tail. analysis of the deduced amino acid sequence strongly sug ... | 1990 | 1698669 |
| influence of fatty acid composition of diet on cholesterol content of eel liver and muscle. | the influence of different diets on cholesterol content of liver and muscle of european eel (anguilla anguilla) was studied for the first time. in control eel, cholesterol constituted near 7.5% of total lipids in liver and about 1% in muscle. feeding herring meal-55% diet produced a drastic increase in hepatic cholesterol after a 30 d period. in muscle, cholesterol content also increased after any dietary treatment. free cholesterol represented about 34% of total cholesterol in liver and about 5 ... | 1990 | 1692683 |
| significant year-to-year variation of the response to radiation-induced stress shown by gill fatty acid metabolism in eels (anguilla anguilla) captured from the wild. | 1. in eels captured in roskilde fjord in 1972 and 1975, a specifically enhanced synthesis was found from 14c-acetate of 14c-labelled mono-unsaturated fatty acids (c16:1 and c18:1) relative to saturated fatty acids (c16:0 and c18:0) in sea water 4 days after irradiation (10 gy, 60co). 2. corresponding experiments in 1976 and 1982 showed rather the opposite: irradiation resulted in more 14c-labelled saturated fatty acids relative to unsaturated fatty acids, both in fresh and sea water. 3. the latt ... | 1991 | 1677881 |
| age-related decrease in the density of benzodiazepine recognition sites in the brain of the fresh water eel (anguilla anguilla). | the binding parameters of benzodiazepine receptors labeled with [3h]flunitrazepam were investigated in the brain of male adult eels at the trophic phase (4 years old) and of male silver eels (6 year old ocean migrants). the density of [3h]flunitrazepam binding sites was significantly decreased (-26%) in the brain of silver eels compared with younger counterparts. in contrast, the apparent dissociation constant (kd) was not significantly different in the two experimental groups. these results are ... | 1991 | 1667812 |
| lectins from triticum vulgaris and limax flavus are universal antagonists of botulinum neurotoxin and tetanus toxin. | lectins from anguilla anguilla, artocarpus integrifolia, canavalia ensiformis, datora stramonium, glycine max, limax flavus, ricinus communis and triticum vulgaris were tested for their abilities to antagonize the binding of botulinum neurotoxin and tetanus toxin to rat brain membranes and to antagonize the ability of these toxins to block neuromuscular transmission in mouse phrenic nerve-hemidiaphragm preparations. lectins from limax flavus and triticum vulgaris, both of which have affinity for ... | 1991 | 1653841 |
| [implication of growth hormone in experimental induction of vitellogenesis by estradiol-17 beta in female silver eel (anguilla anguilla l.)]. | the effect of different preparations of growth hormone (gh) was assayed with 17 beta-estradiol on vitellogenesis in hypophysectomized or normal female silver eels. vitellogenin (vg) plasma levels were taken as the index of hepatic vitellogenesis. the e2 doses were chosen to give the same pattern for the plasma vg level as in the controls. they decreased or remained undetectable in hypophysectomized or normal animals. gh also failed to induce alone a significant modification. when e2 was injected ... | 1992 | 1638433 |
| affinity purification of antigen-specific serum immunoglobulin from the european eel (anguilla anguilla). | immunization of specimens of the european eel with a hapten-carrier conjugate resulted in a significant rise in anti-hapten titres. antigen-specific immunoglobulin was purified on a matrix onto which the hapten-carrier conjugate had been immobilized. rabbit antisera raised against the product of the affinity purification recognized two molecular moieties. the first was eel immunoglobulin as inferred by the polypeptide composition, i.e. disulphide-linked heavy and light chains of 72 kda and 25 kd ... | 1992 | 1615286 |
| acute toxicity, uptake and clearance of diazinon by the european eel, anguilla anguilla (l.). | the toxicity, accumulation, and elimination of diazinon were investigated for the european eel, anguilla anguilla. the 24, 48, 72 and 96-h median lethal concentrations (lc50) were 0.16, 0.11, 0.09 and 0.08 mg/l, respectively. fish exposed to sublethal concentration (0.042 mg/l) accumulated diazinon in liver and muscle tissues. bioconcentration factors (bcf) of diazinon were 1850 in liver, and 775 in muscle over the 96-h exposure period. upon removal from diazinon containing water the contaminate ... | 1992 | 1593096 |
| white muscle differentiation in the eel (anguilla anguilla l.): changes in the myosin isoforms pattern and atpase profile during post-metamorphic development. | myosin isoforms and their light and heavy chains subunits were studied in the white lateral muscle of the eel during the post metamorphic development, in relation with the myosin atpase profile. at elver stage vi a1 the myosin isoforms pattern was characterized by at least two isoforms, fm3 and fm2. the fast isomyosin type 1 (fm1) appeared during subsequent development. it increased progressively in correlation with the increase in the level of the light chain lc3f. fm1 became predominant at sta ... | 1994 | 1534545 |
| chlorinated hydrocarbons in eels (anguilla anguilla l.) from the river rhine. | 1992 | 1522922 | |
| a comparison of highly unsaturated fatty acid levels in wild and farmed eels (anguilla anguilla). | 1. absolute and relative amounts of eicosapentaneoic acid (epa) and docohexaenoic acid (dha) in muscle of eels from four different fish farms were compared with samples from wild eels from two different areas of northern italy. 2. farmed eels were richer in dha and epa than wild animals. 3. the addition of cod liver oil to the diet of farmed eels led to a significant accumulation of epa and dha, but no change in total lipid content. 4. the calculation of two indices related to highly unsaturated ... | 1992 | 1499279 |
| lindane-induced changes in carbohydrate metabolism in anguilla anguilla. | 1. anguilla anguilla (l.) was exposed to a sublethal concentration of 0.167 ppm (0.25 of the 96-hr lc50) of lindane for 6, 12, 24, 48, 72 and 96 hr. 2. changes in glycogen, glucose, pyruvate and lactate contents of liver and muscle after lindane exposure, were studied. 3. muscle and liver glycogen levels decreased significantly during the exposure time. muscle glucose values increased but on the other hand we found a decrease in those of liver. 4. muscle and liver pyruvate content increased as d ... | 1992 | 1379899 |
| atrial natriuretic peptide in the eel, anguilla anguilla l.: its cardiac distribution, receptors and actions on isolated branchial cells. | the presence of atrial natriuretic peptide (anp) and the nature of its binding sites were studied in fresh-water (fw)- and seawater (sw)-adapted eels using a heterologous analogue, that of the rat (ranp). rat anp-like immunoreactivity was demonstrated in the cardiac atria and ventricles of both fw and sw eels, and electron-dense anp-like granules were observed. the atria and ventricles of fw eels contained significantly more granules than those of sw animals and, in both types, the atria were mo ... | 1992 | 1329803 |
| h+/glycyl-glycine cotransport in eel intestinal brush-border membrane vesicles: studies with the ph-sensitive dye acridine orange. | monitoring the fluorescence quenching of the ph-sensitive dye acridine orange, proton accumulation in the presence of an inside-negative transmembrane potential was measured in eel (anguilla anguilla) intestinal brush-border membrane vesicles. it was demonstrated that the proton accumulation was specifically increased by the presence of the dipeptide glycyl-glycine in the extravesicular space, showing saturation kinetics at increasing dipeptide concentrations and was specifically inhibited by di ... | 1992 | 1327139 |
| the use of texture analysis for the discrimination of nissl substance in neurons. | structural changes induced by cordotomy in the nissl substance of identifiable spinal motoneurons innervating the white musculature of the european eel were quantified with the use of texture features calculated from digitized images. data were evaluated and the motoneurons classified by using multivariate analysis. the study shows that there are differences in the structural organization of the nissl substance of motoneurons taken from control and cordotomized fishes. distinction could only be ... | 1992 | 1282188 |
| effect of environmental salinity change on osmotic permeability of the isolated gill of the eel, anguilla anguilla l. | net water fluxes in the isolated gills of anguilla anguilla were studied during incubation in fresh water (fw) and in sea water (sw). when incubated in fw, water entry was greater in sw-adapted eels than in fw-adapted eels. in contrast, water loss in sw was less in sw-adapted eels than in fw-adapted eels. rectification of osmotic water fluxes was observed for both fw and sw-adapted eels, net water fluxes in the mucosal-serosal (m-s) direction being greater than those in the opposite (s-m) direct ... | 1976 | 1263144 |
| metabolic and hematological effects of starvation in the european eel, anguilla anguilla l.--iii. fatty acid composition. | 1976 | 1261240 | |
| effects of calcitonin and ultimobranchialectomy (ubx) on calcium and bone metabolism in the eel, anguilla anguilla l. | prolonged administration of synthetic salmon calcitonin (sct) to immature female silver eels, maintained in sea water, provoked a decrease of the serum calcium concentration and an increase of both the osteoblastic apposition and of the degree of mineralization of the intercellular matrix in the vertebral bone. the osteoclastic resorption and osteocytic osteolysis were not significantly affected, however the osteoclastic index was reduced. the ultimobranchial body, site of ct secretion, was caut ... | 1976 | 1260486 |
| trying to explain an effect of "per se" hydrostatic pressure on heart rate in fish. | specific effects of "per se" hydrostatic pressure on mean heart rate have been studied on eels (anguilla anguilla l.), both untreated and treated with atropine and propranolol, and on isolated eel's heart. because temperature brings, by itself, heart rate modifications in fish, a quantitative study was performed in order to take away the increment of heart rate due to the water warming, which cannot entirely be suppressed during compression. the specific effects of "per se" pressure have been id ... | 1976 | 1259668 |
| the saccus vasculosus of anguilla anguilla (l.) from larva to adult. i. ultrastructural modifications of the coronet cells. | the ultrastructure of coronet cells of the saccus vasculosus has been studied in specimens of anguilla anguilla (l.) at different stages of its life cycle. at all the stages observed coronet cells are composed of a basal and an apical part, the latter bearing globules with primary vesicles. in the larva (a marine form) and in the fully metamorphosed small eel at the time of entry into freshwater the narrow lumen and the vesicles within the apical globules are filled with electron-dense material. ... | 1976 | 1253249 |
| [water balance in the european eel (anguilla anguilla l.). role of the oesophagus in the utilisation of drinking water and a study of the osmotic permeability of the gills (author's transl)]. | 10 new experimental devices are described which allow chonic measurements of drinking rate and osmotic gill permeability in the eel. 20 the oesophagus of the seawater (sw) silver eel plays a role in osmoregulation. it decreases the concentration of cl- and na+ of the ingested sw without losing water in the serosal to mucosal direction. this allows for immediate water absorption in the intestine and decreases the quantity of ions actively absorbed by the intestine. in the freshwater (fw) silver e ... | 1975 | 1223264 |
| [demonstration of leucine aminopeptidase in the peritoneal epithelium of early post-larval stages of anguilla anguilla l.)]. | the coelom of elvers (anguilla anguilla l.), eel0, is contenting glycoproteids, but these are not improvable in following stages of development. in peritoneal epithelium of eel0 activity of leucinamino-peptidase is present, but absent in the stage 2a. we can suppose that glycoproteids vanish by enzymatic catabolism and resorption within the peritoneal epithelium. | 1975 | 1213251 |
| [electroencephalographic study of the eel (author's transl)]. | 1 this paper describes a method for electroencephalographic recording from unanesthetized and unraistrained european eels (anguilla anguilla l.). 2 eeg's records from the cerebellum, tectum opticum, telencephalon and olfactory bulb of the eel are compared with other fish previously studied by other authors. 3 averaged evoked visual potentials from the telencephalon, tectum opticum and cerebellum are presented. 4 this study provides a reference point for future research on fish vigilance depth an ... | 1975 | 1206586 |
| responses of the ultimobranchial body in eels (anguilla anguilla l.) maintained in sea water and experimentally matured, to injections of synthetic salmon calcitonin. | the effect of a synthetic salmon calcitonin (sct) treatment on ultimobranchial body (ub) activity in eels (anguilla anguilla l.) maintained in seawater and submitted to experimental maturation, has been studied histologically. 2. the activity of the glands of a control group of eels maintained in sea water was taken as a reference. 3. the ub parenchyma showed a marked atrophy in the fish treated with sct alone and serum calcium decreased significantly in this group. 4. immature female silver eel ... | 1975 | 1201598 |
| [comparative metabolism of phospholipids of osmoregulation effector organs in european eel (anguilla anguilla)]. | the phospholipid composition from various organs of the fresh water eel, such as gill, kidney, gut, liver and muscle, were determined by thin-layer chromatography. the major phosphatides found in these tissues were pc, pe and sph and minor constituents ps, pi, dpg, ap and also lpc in the gut. a greater percentage of ps and sph occurs in the osmoregulatory effector organs such as gill, kidney, and gut. from in vivo comparative kinetic studies of the 32p incorporation into the phospholipids, betwe ... | 1975 | 1182217 |
| sensitivity of eels (anguilla anguilla) and carp (cyprinus carpio) to type c and e botulinum toxin. | this study has shown for the first time that fish such as eels (anguilla anguilla l.) and carp (cyprinus carpio l.) are sensitive to type e botulinum toxin. with oral administration the mld for eels was 27.500 mouse ld50 per kg body weight, while for carp it was only 236 mouse ld50 per kg. carp were also found to be sensitive to a slight degree to type c botulinum toxin, the mld of the most virulent toxin of this type being 457,000 mouse ld50 per kg with oral administration. eels, however, showe ... | 1975 | 1179868 |
| [histological, histochemical and histophysiological changes of the exocrine pancreas and stomach fundus in anguilla anguilla l. in the course of postlarval development]. | during the postlarval development of eels exocrine status of pancreas and fundus was investigated. therefore results of histomorphological, histophysiological and histochemical tests were interpreted. the conclusion is that there is no secretory activity till stage i. no relation exists between secretory activity and food-supply. | 1975 | 1158098 |
| effect of salmon calcitonin on calcium and sodium efflux in the european eel (anguilla anguilla l.) | 1975 | 1142281 |