Publications

TitleAbstractYear
Filter
PMID(sorted descending)
Filter
ptl-1, a caenorhabditis elegans gene whose products are homologous to the tau microtubule-associated proteins.the tau microtubule-associated proteins are axonal proteins that have been implicated in axonal outgrowth, microtubule spacing, and microtubule bundling. moreover, tau is the major structural component of the paired helical filaments present in the brains of alzheimer's disease patients. the caenorhabditis elegans genome sequencing consortium identified a genomic sequence with homology to the repeat region of tau. pcr, northern analyses, and cdna sequencing were used here to identify transcripts ...19968755720
variation in repeat number within the alpha c protein of group b streptococci alters antigenicity and protective epitopes.variable expression of repeating units of the protective alpha c proteins among clinical isolates of group b streptococci (gbs) may have implications for vaccine development. in this study, alpha c protein genes containing various numbers of repeats (1,2,9, and 16) were cloned in a t7 overexpression vector in escherichia coli. expression was induced by isopropyl-beta-d-thiogalactopyranoside, and proteins were purified by anion-exchange, gel filtration, or affinity chromatography or by isoelectri ...19968751902
identification of surface-exposed linear b-cell epitopes of the nonfimbrial adhesin cs31a of escherichia coli by using overlapping peptides and antipeptide antibodies.as a first step toward the design of an epitope vaccine, by using the nonfimbrial adhesin cs31a of escherichia coli as a carrier, a low-resolution topological and epitope map of the cs31a subunit was developed by using solid-phase peptide synthesis and polyclonal rabbit antibodies raised against both native and denatured proteins. peptides constituting antigenic epitopes on the major subunit (clpg) of the multimeric cs31a antigen were identified by examining the binding of the antibodies to 249 ...19968751899
the lysine-1 analog of guanylin induces intestinal secretion and natriuresis in the isolated perfused kidney.guanylin is an endogenous peptide synthesized by several mammalian species that mimics the effects of a thermostable enterotoxin of escherichia coli (sta: ntfyccelccnpacagcy) in the gut. we have cloned a lysine-1 derivative of rat guanylin (lys-1-ntceicayaactgc) and tested its effects on ileal tissue membranes in ussing chambers and in the isolated perfused rat kidney. rabbit ileal mucosa membranes were mounted into a ussing chamber and the effects of lys-1 guanylin (lys-1 g) and sta enterotoxin ...19968731359
nontoxigenic vibrio cholerae 01 serotype inaba biotype el tor associated with a cluster of cases of cholera in southern india.thirteen strains of vibrio cholerae 01 belonging to the inaba serotype el tor biotype isolated from patients during an outbreak of cholera in the town of warangal in southern india were found to be nontoxigenic (nt), since they did not produce cholera toxin or hybridize with dna probes specific for cholera toxin, zot, or ace. the unheated and heated culture supernatants of the nt v. cholerae 01 evoked a rapid cell-rounding effect when introduced on confluent layers of cho and hela cells which co ...19968727886
parathyroid hormone-related protein is induced during lethal endotoxemia and contributes to endotoxin-induced mortality in rodents.parathyroid hormone-related protein (pthrp) is a ubiquitous and highly conserved vasoactive peptide whose role and regulation in normal physiology remain an enigma. recently, we demonstrated that low-dose endotoxin (lps) induces intrasplenic, but not systemic, levels of pthrp; and that tumor necrosis factor, a pro-inflammatory cytokine, is the major mediator of this effect. we have therefore hypothesized that, with higher, lethal doses of endotoxin, pthrp could be induced in multiple tissues to ...19968726463
a continuous epitope from transmissible gastroenteritis virus s protein fused to e. coli heat-labile toxin b subunit expressed by attenuated salmonella induces serum and secretory immunity.antigenic site d from the spike protein of transmissible gastroenteritis virus (tgev), which is a continuous epitope critical in neutralization, has been expressed as a fusion protein with e. coli heat-labile toxin b subunit (lt-b) in attenuated s. typhimurium. synthetic peptides containing the sequence of site d induced tgev neutralizing antibodies when inoculated subcutaneously in both rabbits and swine. a synthetic oligonucleotide encoding residues 373-398 of tgev s protein, including antigen ...19968725098
production, analysis and bioactivity of recombinant vasoactive intestinal peptide analogs.recombinant vasoactive intestinal polypeptide (vip) analogs were expressed in escherichia coli as a fusion protein containing tandemly repeated multiple copies of a synthetic vip gene joined to glutathione s-transferase. the encoded protein contains vip units separated by a linker peptide, potentially excisable by a double cleavage with endoprotease factor xa and hydroxylamine. expression of different polyvip genes, from 1 to 32 units, was detected and the production of a 16 vip polymer was perf ...19968725006
[major p50 protein of the somatic cell cytoplasmic mrnp: expression in escherichia coli, isolation, and some properties of the recombinant protein].the major mrnp protein of rabbit reticulocytes, p50, belonging to the family of y-box transcription factors has been expressed in e. coli. the isolation procedure of the recombinant protein has been described. the recombinant protein is similar to the protein isolated from rabbit mrnps in sds-page mobility and interaction with specific antibodies. similar to the natural protein, the recombinant protein forms homooligomeric complexes with a molecular mass of about 800 kda, binds to the alpha-glob ...19968724611
heterologous expression and characterisation of mouse brain fatty acid binding protein.a novel brain-type member of the fatty acid binding protein family (b-fabp) was heterologously expressed in escherichia coli, either as inclusion bodies at 37 degrees c or in soluble form at 22 degrees c. both b-fabp renatured from inclusion bodies and the solubly expressed protein could be purified to homogeneity by anion exchange chromatography and gel filtration in a functional conformation as they bound oleic acid with high affinity. none of the five cysteines of b-fabp was involved in disul ...19968722323
characterization of a schistosoma mansoni cdna encoding a b-like cyclophilin and its expression in escherichia coli.a cdna encoding a schistosoma mansoni cyclophilin (smcyp) has been cloned by polymerase chain reaction amplification using degenerate oligonucleotides based on known conserved cyclophilin (cyp) sequences and by screening an expression cdna library. the cdna sequence encodes a 21.5-kda protein, which shares 59% sequence identity with human cyp b. the smcyp protein was expressed in escherichia coli with a hexahistidine affinity tag at its amino terminus and antibodies to the purified (his6)-smcyp ...19958720179
expression of senescence-induced protein ws3-10 in vivo and in vitro.in our efforts to characterize cellular senescence we have shown that the mrna encoding ws3-10 protein is overexpressed in senescent human diploid fibroblasts (hdf) when compared with their younger counterparts, and that forced expression of the ws3-10 cdna in young hdf results in suppression of calcium-dependent membrane currents, presumably due in part to the presence of a calcium binding domain within the ws3-10 protein. we have now expressed this protein in e. coli and have obtained affinity ...19968706785
membrane topography and near-neighbor relationships of the mitochondrial atp synthase subunits e, f, and g.the well characterized subunits of the bovine atp synthase complex are the alpha, beta, gamma, delta, and epsilon subunits of the catalytic sector, f1; the atpase inhibitor protein; and subunits a, b, c, and d, oscp (oligomycin sensitivity-conferring protein), f6, and a6l, which are present in the membrane sector, f0, and the 45-a-long stalk that connects f1 to f0. it has been shown recently that bovine atp synthase preparations also contain three small polypeptides, designated e, f, and g, with ...19968702768
high-level expression of tree pollen isoallergens in escherichia coli.cdnas coding for the major allergen of alder (alnus glutinosa) pollen aln g 1, for nine isoforms of bet v 1, the major birch (betula verrucosa) pollen allergen, and for four isoforms of cor a 1, the major allergen of hazel (corylus avellana) pollen, were inserted into the plasmid pmw175 or pmw 172 and expressed in escherichia coli as recombinant non-fusion proteins. these constructs produced between 20 and 160 mg protein/l. the recombinant tree pollen isoallergens were tested in immunoblots for ...19968688676
pstb protein of the phosphate-specific transport system of escherichia coli is an atpase.the pstb protein of the phosphate-specific transport (pst) system of escherichia coli bound and hydrolyzed atp, producing adp. urea-treated denatured pstb did not bind atp. the n-terminal amino acid sequence of the immune serum-precipitable pstb protein was determined, and it corresponded to that deduced from the dna sequence.19968682808
truncated enterohemorrhagic escherichia coli (ehec) o157:h7 intimin (eaea) fusion proteins promote adherence of ehec strains to hep-2 cells.intimin, the product of the eaea gene in enterohemorrhagic escherichia coli o157:h7 (ehec), is required for intimate adherence of these organisms to tissue culture cells and formation of the attaching and effacing lesion in the gnotobiotic pig. because of the importance of intimin in the pathogenesis of ehec o157:h7 infection in this animal model, we began a structure-function analysis of eaea. for this purpose, we constructed amino-terminal fusions of the intimin protein with six histidine resi ...19968675331
inhibition of the hemolytic activity of the first component of complement c1 by an escherichia coli c1q binding protein.molecular mimicry is a well established mechanism via which bacteria protect themselves from complement-mediated killing. we have previously demonstrated that a number of human cells express receptors for c1q (c1qr) and that the soluble form of this receptor inhibits activation of the classical pathway of complement. we now investigated whether escherichia coli possesses a c1qr-like protein that protects these bacteria from complement-mediated injury. by facs analysis it was shown that approxima ...19968666822
reconstitution of the steroid receptor.hsp90 heterocomplex assembly system of rabbit reticulocyte lysate.rabbit reticulocyte lysate contains a multiprotein system that assembles steroid receptors into a heterocomplex with hsp90. in the case of the glucocorticoid receptor (gr), the receptor must be bound to hsp90 to bind steroid, and assembly of the gr.hsp90 complex restores the hormone binding domain of the receptor to the steroid binding conformation. using both direct assay of heterocomplex assembly by western blotting and indirect assay of assembly by steroid binding, it has previously been dete ...19968662785
cloning, expression and characterization of the proteinase from human herpesvirus 6.after the u53 gene encoding the proteinase from human herpesvirus 6 (hhv-6) was sequenced, it was expressed in escherichia coli, and the activity of the purified, recombinant hhv-6 proteinase was characterized quantitatively by using synthetic peptide substrates mimicking the release and maturation cleavage sites in the polyprotein precursors of hhv-6, human cytomegalovirus (cmv), murine cmv, and epstein-barr virus. despite sharing 40% identity with other betaherpesvirus proteinases such as huma ...19968648756
expression in escherichia coli of sin a 1, the major allergen from mustard.sin a 1, the major yellow mustard allergen, is a seed storage protein that belongs to the 2s albumin family. it is composed of two disulfide-bonded polypeptide chains. the cloning of this allergen has been carried out by means of the polymerase chain reaction using non-degenerate oligonucleotides encoding the n-terminal and c-terminal regions of the mature protein as primers. five genomic nucleotide sequences have been analyzed, encoding both mature polypeptide chains linked by the internal proc ...19968647131
putative steroid binding domain of the human mineralocorticoid receptor, expressed in e. coli in the presence of heat shock proteins shows typical native receptor characteristics.domain e, considered as the putative hormone binding domain (hbd) of the human mineralocorticoid receptor (hmr) was expressed in escherichia coli as a fusion protein with either maltose binding protein (mbp) or glutathione s-transferase (gst). these bacterially-produced mr constructs had no steroid binding activity per se. in fact, heat shock protein association (hsp) is required for high affinity ligand-binding of the mr. after incubation of purified mbp- or gst-hbd with rabbit reticulocyte lys ...19968645616
development and evaluation of an elisa to detect escherichia coli k88 (f4) fimbrial antibody levels.an enzyme-linked immunosorbent assay (elisa) to determine igg antibody levels against k88 (f4) fimbrial antigen from porcine enterotoxigenic escherichia coli (etec) has been developed. the elisa method was checked with serum samples obtained from rabbits and pigs, and the parameters affecting the method were also analysed. elisa plates were optimally coated with k88 antigen 0.5 microgram/ml for testing rabbit antiserum or with 1.25 microgram/ml for testing pig serum. optimal concentrations of h2 ...19968636963
removal of map4 from microtubules in vivo produces no observable phenotype at the cellular level.microtubule-associated protein 4 (map4) promotes mt assembly in vitro and is localized along mts in vivo. these results and the fact that map4 is the major map in nonneuronal cells suggest that map4's normal functions may include the stabilization of mts in situ. to understand map4 function in vivo, we produced a blocking antibody (ab) to prevent map4 binding to mts. the cooh-terminal mt binding domain of map4 was expressed in escherichia coli as a glutathione transferase fusion protein and was ...19968636213
the isolation and characterization of a novel corticostatin/defensin-like peptide from the kidney.we report the isolation and characterization of rk-1, a novel peptide found in the kidney. rk-1 is related to the corticostatin/defensins and has the sequence mpc-sckkycdpwevidgscglfnskyccrek but differs from the very cationic corticostatins/defensins in having only one arginine and a calculated charge at ph 7 of +1. like some myeloid corticostatin/defensins rk-1 inhibits the growth of escherichia coli. since corticostatin/defensins effect ion flux in responsive epithelia we used volume changes ...19968631871
a noncovalent complex vaccine prepared with detoxified escherichia coli j5 (rc chemotype) lipopolysaccharide and neisseria meningitidis group b outer membrane protein produces protective antibodies against gram-negative bacteremia.earlier studies showed that purified igg from sera of rabbits immunized with a boiled escherichia coli j5 (rc chemotype) whole cell vaccine protected neutropenic rats against gram-negative bacterial sepsis. in the present study, de-o-acylated j5 lipopolysaccharide (j5 dlps) as a noncovalent complex with neisseria meningitidis group b outer membrane protein (gbomp) elicited anti-j5 lps antibodies in rabbits. igg prepared from immune rabbit sera protected neutropenic rats against lethal challenge ...19968627067
different glycosylation requirements for the synthesis of enzymatically active angiotensin-converting enzyme in mammalian cells and yeast.for facilitating crystallization and structural studies of the testicular isozyme of angiotensin-converting enzyme (ace,), we attempted the production of enzymatically active acet proteins which are unglycosylated or underglycosylated. expression in escherichia coli of the rabbit acet cdna resulted in the synthesis of an unglycosylated but inactive protein. similarly, unglycosylated acet synthesized in hela cells, by using a cdna in which all five potential n-glycosylation sites had been mutated ...19968626443
effects of conserved residues on the regulation of rabbit muscle pyruvate kinase.a cdna encoding the complete rabbit muscle pyruvate kinase isozyme (rmpk) was cloned using the method of rapid amplification of cdna ends. the sequence encodes a polypeptide chain of 530 amino acids which differs in three amino acid residues from a sequence reported by larsen et al. (larsen, t.m., laughlin, t., holden, h.m., rayment, l, and reed, g.h. (1994) biochemistry 33, 6301-6309). glu233-gln234 and ala400 were identified instead of asp233-glu234 and ser400, respectively. the recombinant rm ...19968626426
effects of reconstituted high-density lipoprotein in persistent gram-negative bacteremia.reconstituted high-density lipoproteins (rhdl) have been shown bind bacterial lps and reduce its toxic effects. since the effect of rhdl on lps in vitro cannot be directly extrapolated to the in-vivo picture of gram-negative septic shock, we have investigated the effects of rhdl in a rabbit model of gram-negative bacteremia. rabbits were anesthetized, ventilated, and invasively monitored for 6 hours. escherichia coli (4 x 10(9) cfu/kg) were infused over 2 hours in rabbits given rhdl (75 mg/kg) b ...19968615560
prostaglandin e2 production by endotoxin-stimulated alveolar macrophages is regulated by phospholipase c pathways.eicosanoids play an important role in many aspects of systemic inflammatory responses and host defense. although the synthesis of eicosanoids by different enzymes has been elucidated, the regulatory mechanism of eicosanoid production is not clear. we designed this study to investigate the hypothesis that pge2 production by endotoxin (lipopolysaccharide; lps)-stimulated macrophages (mo) is dependent on phospholipase c (plc) signaling pathways.19968614032
pathogenesis of corneal infection: binding of pseudomonas aeruginosa to specific phospholipids.clinical isolates of pseudomonas aeruginosa were examined for binding interactions with phospholipids of corneal epithelium. thin-layer chromatography (tlc) of lipids extracted from corneal epithelia followed by staining with an ammonium molybdate spray reagent revealed three phospholipid components, pl1, pl2, and pl3. the chromatographic mobility of pl1 was similar to that of the phospholipid standards phosphatidylinositol (pi) and phosphatidylserine (ps), which were not well resolved from one ...19968613396
interaction of verotoxin 2e with pig intestine.in pigs with edema disease, verotoxin 2e (vt2e) is produced in the intestine and transported to tissues, but neither the mechanism by which toxin passes through the intestine nor its failure to induce an enterotoxic reaction is understood. binding of vt2e to pig intestine was examined by enzyme-linked immunosorbent assay involving microvillus membranes (mvm) and crude mucus; thin-layer chromatographic overlay immunoassay with total lipids extracted from mvm; and indirect immunofluorescence of to ...19968613382
anti-peptide immunoglobulins from rabbit and chicken eggs recognise recombinant human dihydroorotate dehydrogenase and a 44-kda protein from rat liver mitochondria.mitochondrially bound dihydroorotate dehydrogenase catalyses the fourth sequential step in the de novo synthesis of uridine monophosphate. 312-bp and 983-bp regions of the human dihydroorotate dehydrogenase sequence (1496 bp) were amplified by the polymerase chain reaction, and subcloned into the expression vector pqe 32. the identity of the pcr products was verified by dideoxynucleotide sequencing. transformation of escherichia coli strain m15 resulted in expression of 13-kda and 36-kda protein ...19968612635
lidocaine attenuates the hypotensive and inflammatory responses to endotoxemia in rabbits.to assess the effects of lidocaine on the hemodynamic and inflammatory responses to escherichia coli endotoxemia in rabbits.19968612417
the protective role of enteral iga supplementation in neonatal gut-origin sepsis. 19968611004
identification of a set of proteins (c' and c) encoded by the bicistronic p gene of the indiana serotype of vesicular stomatitis virus and analysis of their effect on transcription by the viral rna polymerase.previous work (c.f. spiropoulou and s.t. nichol, 1993, j. virol. 67, 3103-3110) has demonstrated the existence in cells infected with the new jersey serotype of vesicular stomatitis virus (vsv) of two small carboxy-coterminal proteins encoded by the p mrna. these proteins have been named c' and c. we are interested in studying the function of these proteins in the virus life cycle. toward this end, we have cloned the orf encoding the potential c' protein of the indiana serotype as a histidine-ta ...19968610460
use of prozz-obelin fusion protein in bioluminescent immunoassay.obelin is a photoprotein that emits light by ca2+-binding. to develop a bioluminescent immunoassay based on the light emission property of obelin, we have expressed the apoobelin fusion protein with zz-domain of s. aureus protein a in e. coli by recombinant dna techniques. the prozz-obelin expressed was purified by one-step affinity chromatography on igg-agarose. the purified prozz-obelin has both the luminescent activity of obelin and the igg-binding ability of zz-domain. the specific activity ...19968605012
crystal structure of escherichia coli pyruvate kinase type i: molecular basis of the allosteric transition.pyruvate kinase (pk) plays a major role in the regulation of glycolysis. its catalytic activity is controlled by the substrate phosphoenolpyruvate and by one or more allosteric effectors. the crystal structures of the non-allosteric pks from cat and rabbit muscle are known. we have determined the three-dimensional structure of the allosteric type i pk from escherichia coli, in order to study the mechanism of allosteric regulation.19958591049
effect of cloned salmonella typhimurium enterotoxin on rabbit intestinal motility.we analysed the small intestine myoelectric responses of anesthetized new zealand albino rabbits to escherichia coli lysates containing an entertoxin cloned from salmonella typhimurium. migrating action potential complex, which consisted of rapid bursts of actions potentials and secretion of fluid, was observed only in ileal loops, injected with the enterotoxin-containing lysate. migrating action potential complex produced by stn usually propagated aborally, which was typical of cholera toxin, b ...19958586274
autoimmunity in chronic active helicobacter hepatitis of mice. serum antibodies and expression of heat shock protein 70 in liver.male a/jcr mice with naturally occurring helicobacter hepaticus infection develop a progressive chronic active hepatitis and liver tumors, despite the presence of serum antibodies to helicobacter proteins. a rabbit antiserum prepared against the bacterial proteins immunoreacted with hepatocytes present in liver sections from infected mice with progressive lesions. we found that sera from these mice contained igg antibodies that reacted in immunoblots with recombinant heat shock protein 70 (dmak ...19968579113
study of hemagglutinating property of enteroinvasive escherichia coli from various geographical locations.thirty-four strains of enteroinvasive escherichia coli (eiec) were examined for their ability to agglutinate erythrocytes from different animal species. all strains cultured in casamino acid-yeast extract medium in the presence of 1 mm cacl2 at 37 c for 16-22 hr induced maximal expression of hemagglutination (ha) of broad spectrum erythrocytes. the strongest ha was observed with guinea-pig erythrocytes followed by human (o type), rat, mouse, rabbit and sheep erythrocytes. all the strains failed ...19958569044
protective immunity to shiga-like toxin i following oral immunization with shiga-like toxin i b-subunit-producing vibrio cholerae cvd 103-hgr.this study addresses a mechanism for inducing systemic immunity to shiga-like toxins by oral administration of a shiga-like toxin i b-subunit-expressing vibrio cholerae vaccine strain [cvd 103-hgr(pda60)]. two sets of three rabbits were given either cvd 103-hgr or cvd 103-hgr(pda60) orally. all rabbits immunized with cvd 103-hgr(pda60) developed neutralizing serum antibodies to shiga-like toxin i. none of the controls developed such antibodies.19968557364
angiogenin single-chain immunofusions: influence of peptide linkers and spacers between fusion protein domains.the gene for human angiogenin (ang), a member of the ribonuclease superfamily, was fused to a gene encoding a single-chain antibody (sfv) against the human transferrin receptor. three ang single-chain immunofusion proteins (angsfvs) were constructed with variations in the type of linker connecting the vl and vh chain [egkssgsgseskef, l1 or (ggggs)3, l2] as well as with or without a spacer (fb) connecting the ang and sfv (angfbsfvl1 or l2; angsfv(l2)]. although the nature of the linker did not af ...19968555226
aggregation-promoting factor in pig intestinal lactobacillus strains.autoaggregation was frequently encountered among intestinal lactobacilli isolated from weaned pigs. the aggregation mechanism was shown to be mediated by the production of a proteinaceous aggregation-promoting factor in two strains of lactobacillus reuteri. a 32 kda aggregation-promoting protein was detected in these strains by cross-reaction with rabbit polyclonal antibodies for aggregation-promoting factor produced by the human isolate lact. plantarum 4b2. coaggregation reactions of lact. reut ...19958554760
pai-1-resistant t-pa: low doses prevent fibrin deposition in rabbits with increased pai-1 activity.the present study compared the activities of recombinant tissue-type plasminogen activator (t-pa) and a plasminogen activator inhibitor-1 (pai-1)-resistant variant t-pa (kt-pa, khrr 296-299 aaaa) in preventing renal fibrin deposition in rabbits with elevated pai-1 activity. in this model, all rabbits were infused with endotoxin (10 micrograms/kg), followed by initiation of thrombin (130 u/kg) 4 hours later, when plasma pai-1 activity was greater than 200 arbitrary units (au)/ml (baseline, < 3 au ...19968547635
calcium and calmodulin regulate lipopolysaccharide-induced alveolar macrophage production of tumor necrosis factor and procoagulant activity.alterations in macrophage (m phi) function are responsible, in part, for adult respiratory distress syndrome and multiple organ failure developing in patients with sepsis. elucidation and control of these m phi mechanisms during sepsis are crucial to our understanding of this disease and, ultimately, to improving survival of these patients.19968546576
molecular characterization of golgin-245, a novel golgi complex protein containing a granin signature.the serum from a sjögren's syndrome patient with anti-golgi antibodies was used as a probe to isolate a 4.6-kilobase pair cdna insert from a hela cdna library. expression of the cdna in escherichia coli and the in vitro translation products of the cdna yielded a recombinant protein that migrated in sds-polyacrylamide gel electrophoresis at 180 kda. this protein was immuno-precipitated by the human anti-golgi serum and by immune rabbit serum but not by normal human serum or preimmune rabbit serum ...19958537393
production of recombinant human brain type i inositol-1,4,5-trisphosphate 5-phosphatase in escherichia coli. lack of phosphorylation by protein kinase c.the dephosphorylation of inositol 1,4,5-trisphosphate (insp3) to inositol 1,4-bisphosphate is catalyzed by insp3 5-phosphatase. the coding region of human brain type i insp3 5-phosphatase was expressed as a fusion protein with the maltose-binding protein (mbp) in escherichia coli, using the pmal-cr1 vector. the relative molecular mass of the purified fusion protein (mbp-insp3-5-phosphatase) was approximately m(r) 85,000 as analysed by sds/page. the yield was about 10 mg fusion protein/l lysate. ...19958536709
expression, purification, and characterization of human cytosolic serine hydroxymethyltransferase.a cdna which codes for human cytosolic serine hydroxymethyltransferase (garrow et al., 1993, j. biol. chem. 268, 11910-11916) has been cloned into a pt7-7 vector as a ndei-ecori insert. hms174 (de3) cells were transformed with this plasmid and, after induction with isopropyl thiogalactoside, expressed a catalytically active serine hydroxymethyltransferase. the enzyme was purified and shown to be the expressed human enzyme by n-terminal amino acid sequencing. about 225 mg of pure enzyme can be ob ...19958527925
effects of concanavalin a and pokeweed lectins on microvillar membrane proteins during the organ culture of rabbit intestinal mucosa.the effects of pokeweed lectin (pwl) and concanavalin a (con a) on microvillar membrane (mvm) proteins during the organ culture of rabbit ileal explants for 24 hours were compared with the known effects of enteropathogenic escherichia coli (epec). pwl resulted in the accelerated release of brush border enzymes into the culture medium, accompanied by decreased tissue activities and an increase in the total activity present in the tissue and culture medium. con a had less effect on the release and ...19958525086
prenylation analysis of bacterially expressed and insect cell-expressed ras and ras-related proteins. 19958524132
assay and expression of mitogen-activated protein kinase, map kinase kinase, and raf. 19958524112
two stages of enteropathogenic escherichia coli intestinal pathogenicity are up and down-regulated by the epithelial cell differentiation.pathogens and eucaryotic cells are active partners during the process of pathogenicity. to gain access to enterocytes and to cross the epithelial membrane, many enterovirulent microorganisms interact with the brush border membrane-associated components as receptors. recent reports provide evidence that intestinal cell differentiation plays a role in microbial pathogenesis. human enteropathogenic escherichia coli (epec) develop their pathogenicity upon infecting enterocytes. to determine if intes ...19958522069
construction, characterization, and selected site-specific mutagenesis of an anti-single-stranded dna single-chain autoantibody.single-chain antibodies are comprised of immunoglobulin light and heavy chain variable domains joined through a polypeptide linker. a single-chain autoantibody, containing the 14-amino acid 212-polypeptide linker (gstsgsgkssegkg), was constructed based on the light and heavy chain variable region gene sequences of anti-single-stranded dna autoantibody bv04-01 (igg2b, kappa). following protein expression in escherichia coli, denaturation, refolding, and affinity purification, single-chain autoant ...19938514799
adjuvant activity of the escherichia coli wf table l-form cytoplasmic membranes.it was established that the stable e. coli wf+ l-form cytoplasmic membranes (cm) increase the antibody response in rabbit during experimental hyperimmunization with cells of streptococcus pyogenes a49 and proteus mirabilis d52. using the skin-induration test and the reaction for aggregation of macrophages in presence of homologous antigens it was established that cm increase the cell-mediated immunity of guinea-pigs to protein antigens of the same bacterial strains.19938511999
rabbit liver microsomal endopeptidase with substrate specificity for processing proproteins is structurally related to rat testes metalloendopeptidase 24.15.the detergent extract of rabbit liver microsomes contains an endopeptidase (mep) with substrate specificity for peptides containing arg residues at the p1 and p4 positions in the cleavage site (kawabata, s., and davie, e. w. (1992) j. biol. chem. 267, 10331-10336). these sequences occur in many proproteins such as the vitamin k-dependent proproteins and prohormones. a cdna coding for mep has been obtained from three overlapping clones isolated from two rabbit liver lambda gt10 cdna libraries. th ...19938509389
vibrio parahaemolyticus has a homolog of the vibrio cholerae toxrs operon that mediates environmentally induced regulation of the thermostable direct hemolysin gene.in an effort to identify the regulatory gene controlling the expression of the tdh gene, encoding the thermostable direct hemolysin of vibrio parahaemolyticus, we examined total dna of aq3815 (a kanagawa phenomenon-positive strain) for sequences homologous to that of the toxr gene of vibrio cholerae. the extracted dna gave a weak hybridization signal under reduced-stringency conditions with a toxr-specific dna probe. cloning and sequence analysis of the probe-positive sequence revealed an operon ...19938509337
immunodiagnosis of group-a streptococci by latex agglutination assays with monoclonal or monospecific polyvalent antibodies.seven clones of murine monoclonal antibodies specific for group-a streptococci were generated. all of them were of igm isotypes and recognized trypsinized as well as nontrypsinized group-a streptococci and polysaccharide. these were devoid of reactivity with streptococci-b, -c, -g and staphylococcus aureus. polyclonal antibodies against group-a polysaccharide (aps) were also raised in rabbits by linking aps to bovine serum albumin, and rendered monospecific by adsorption. latex agglutination ass ...19938486405
identification of eae sequences in enteropathogenic escherichia coli strains from rabbits.dna sequences coding for attachment and for verotoxin production were investigated in a collection of enteropathogenic escherichia coli strains from rabbits. all of the strains produced diarrhea after experimental infection, attached to the brush borders of the intestinal lining, and possessed homology to the eae probe, whereas strains isolated from healthy rabbits did not. sequences homologous to the af/r1 fimbriae of strain rdec-1 were not found. one strain reacted with the probe for the shiga ...19938478111
a review and update on adult syphilis, with particular reference to its treatment.syphilis has become less common in europe in the last decade, but has once again become a major problem in the usa, and remains so in many developing countries. several treponemal genes have now been cloned and expressed in escherichia coli, allowing study of treponemal proteins. the importance of cell mediated immunity in syphilis has been demonstrated in animal models. a diagnosis of syphilis is usually confirmed by dark-field microscopy or serological tests. seroconversion may be delayed in h ...19938476969
characterization of yeast ef-1 alpha: non-conservation of post-translational modifications.elongation factor 1 alpha (ef-1 alpha) is an abundant cellular protein and its amino-acid sequence has been inferred from numerous organisms, including bacteria, archaebacteria, plants and animals. in large measure, it would appear that the overall structure has probably been maintained given the 33% identity and 56% similarity of escherichia coli ef-tu with human ef-1 alpha. chemical sequencing of ef-tu and ef-1 alpha has revealed that these proteins are post-translationally modified. in order ...19938476932
structure-function relationship of a recombinant human galactoside-binding protein.a galactoside-binding lectin (hl-31) containing a collagen-like sequence was identified in human tumor cells. it was found to be the homologue of the ige-binding protein, the macrophage cell-surface mac-2 antigen, and the murine cbp35, rl-29, and ml-34 lectins. here we report on the expression in escherichia coli and functional analysis of recombinant hl-31 (rhl-31). the rhl-31 was purified in one step through an asialofetuin affinity column. the rhl-31 was reactive to anti-lectin antibodies and ...19938476870
cell-free expression of large collections of cdna clones using positive-selection lambda phage vectors. 19938474330
fusion of the genes encoding escherichia coli heat-stable enterotoxin b (stb) and the maltose-binding protein to obtain mature stb enterotoxin.the heat-stable enterotoxin b gene (estb) of escherichia coli was fused to the gene for maltose-binding protein (male). the estb gene was cloned into the pmal-p vector using pcr. the construct consists of the signal sequence of maltose-binding protein, which directs the export of the fusion protein to the periplasm, and the maltose-binding protein fused to the stb polypeptide. a sequence encoding a factor xa cleavage site is present between male and estb. the fused genes are controlled by ptac, ...19938473869
trypanosoma cruzi: characterization of two recombinant antigens with potential application in the diagnosis of chagas' disease.a genomic library of trypanosoma cruzi, constructed in the vector lambda gt11, was screened with a hyperimmune rabbit antiserum against tissue culture trypomastigotes. two clones, b12 and b13, containing inserts of 350 and 600 bp, respectively, were isolated. sequencing data indicated that both clones present a pattern of tandemly repeated nucleotide units of 60 bp for b12 and 36 bp for b13. southern blot analysis suggests that both corresponding genes exist as a single copy. the inserts of both ...19938467895
microbiological status of rabbit carcases in egypt.a total of 40 new zealand white rabbits, 20 freshly slaughtered rabbits from an experimental farm and 20 processed rabbit carcases from grocery stores in beni-suef city, were examined bacteriologically. the mean values of aerobic plate counts at 37 degrees c and 1 degrees c, enterobacteriaceae counts, pseudomonas counts and staphylococcus counts of freshly slaughtered rabbits were 10(4) +/- 2 x 10(3), 8 x 10(2) +/- 10(2), 6 x 10(2) +/- 10(2), 3 x 10(2) +/- 10(2), and 10(2) +/- 60 organisms per g ...19938465608
molecular cloning and expression of cdna for mammalian translation initiation factor 5.eukaryotic translation initiation factor 5 (eif-5) catalyzes the hydrolysis of gtp bound to the 40s ribosomal initiation complex (40s.aug.met-trnaf-eif-2.gtp) with the subsequent joining of a 60s ribosomal subunit resulting in the formation of a functional 80s initiation complex. a rat cdna that encodes eif-5 has been isolated and expressed in escherichia coli to yield a catalytically active eif-5 protein. the 3.55-kb cdna encodes a protein of 429 amino acids (calculated m(r) 48,926) with proper ...19938464924
toxicity of bordetella avium beta-cystathionase toward mc3t3-e1 osteogenic cells.bordetella avium is the etiological agent of an upper respiratory disease in birds which, symptomatically and pathologically, resembles bordetellosis in humans. studies of the virulence of this organism revealed a novel cytotoxic protein, designated osteotoxin, that was lethal for mc3t3-e1 osteogenic cells, fetal bovine trabecular cells, umr106-01(bsp) rat osteosarcoma cells, and embryonic bovine tracheal cells. the osteotoxin lacked dermonecrotic toxin activity, exhibited no cross-reactivity wi ...19938463265
a single amino acid substitution confers progesterone 6 beta-hydroxylase activity to rabbit cytochrome p450 2c3.a cdna encoding a naturally occurring variant of cytochrome p450 (p450) 2c3 that catalyzes the 6 beta- and 16 alpha-hydroxylation of progesterone exhibits six differences of nucleotide sequence leading to five amino acid substitutions from that encoding 2c3, a progesterone 16 alpha-hydroxylase that does not catalyze 6 beta-hydroxylation. analysis of chimeric and mutant enzymes indicates that a ser/thr difference at position 364 underlies the difference between the two enzymes in 6 beta-hydroxyla ...19938463225
expression of a pokeweed antiviral protein in escherichia coli and its characterization.two expression vectors were constructed to produce a putative mature alpha-pokeweed antiviral protein (alpha-pap) in escherichia coli with its nh2- and cooh-terminal extrapeptides excised. one was for its intracellular expression with a methionine at its nh2-terminal. the other was for its secretion using an ompa signal peptide. the former product was purified from the total soluble proteins of the transformant with a yield of 1.74 mg/liter and the latter had a yield of 5.55 mg/liter. both produ ...19938462671
sequential o-glycosylation of nuclear pore complex protein gp62 in vitro.gp62 is a nuclear pore complex glycoprotein of vertebrates containing multiple o-linked n-acetylglucosamine monosaccharides. we have recently shown (cordes et al., eur. j. cell biol. 55, 31-47 (1991)) that gp62 of mouse and xenopus laevis is predominantly glycosylated in the amino-terminal half of the molecule. here we describe in vitro glycosylation in rabbit reticulocyte lysate of gp62 and of individual segments of this protein expressed as recombinant polypeptides in e. coli. competition expe ...19938462594
molecular cloning and expression of the gene for serine hydroxymethyltransferase from an obligate methylotroph hyphomicrobium methylovorum gm2.the gene encoding serine hydroxymethyltransferase (shmt), one of the key enzymes of the one-carbon-compound assimilation of a methylotroph, hyphomicrobium methylovorum gm2, and its flanking regions were isolated using a dna fragment encoding escherichia coli shmt as a probe. nucleotide sequencing of the recombinant plasmids revealed the shmt gene codes for the 434-amino-acid protein with a calculated molecular mass of 46,068 da. the amino-acid sequence of the enzyme showed identity to the sequen ...19938462546
characterization of vaccinia surface antigen expressed by recombinant baculovirus.the gene encoding the vaccinia surface antigen (s antigen) was inserted into a baculovirus transfer vector and a recombinant virus was isolated. the s antigen was expressed on the surface of spodoptera frugiperda cells (sf cells) infected with the recombinant baculovirus. recombinant proteins were detected in immunoblotting with anti-vaccinia serum and have the apparent molecular weight of 40 and 50-kda. the 50-kda polypeptide was tunicamycin sensitive and was thus glycosylated. the glycosylated ...19938460484
characterization of a recombinant t cell and b cell reactive polypeptide of onchocerca volvulus.to identify potentially protective ag of the filarial nematode onchocerca volvulus on the molecular level we screened a cdna library of o. volvulus with a human serum raised against radiation-attenuated infective larvae of o. volvulus. a cdna clone of 218 bp (ovl3-1) was selected for further studies. it was expressed in escherichia coli and affinity purified recombinant polypeptide was tested for its ability to stimulate in vitro pbmc from african onchocerciasis patients and pbmc from chimpanzee ...19938454865
pharmacokinetics of fleroxacin as studied by positron emission tomography and [18f]fleroxacin.a new method of tracing the disposition of fleroxacin was tested in infected and noninfected animals in an effort to develop a technique that might be applicable in humans. [18f]fleroxacin was synthesized and shown to be identical physically, chemically, and in its antimicrobial activity to the commercially produced product. tracer amounts of [18f]fleroxacin were coinjected with a pharmacologic dose of unlabeled drug (10 mg/kg) into normal mice, rats with focal thigh infection due to escherichia ...19938452183
functional characterization of flavin-containing monooxygenase 1b1 expressed in saccharomyces cerevisiae and escherichia coli and analysis of proposed fad- and membrane-binding domains.a cdna encoding the flavin-containing monooxygenase of rabbit lung (fmo 1b1) was expressed in yeast and escherichia coli and the recombinant enzymes characterized. a high copy, isopropyl-1-thio-beta-d-galactopyranoside (iptg)-inducible e. coli expression vector, pkkhc, was used for expression in e. coli strain jm109, and a galactose-inducible vector, yep53, was used for expression in yeast strain 334. following transcriptional induction with iptg or galactose, subcellular fractions were prepared ...19938449936
the p46 subunit of eukaryotic initiation factor (eif)-4f exchanges with eif-4a.the p46 subunit of eukaryotic initiation factor (eif)-4f purified from rabbit reticulocyte lysate has previously been found to be composed of eif-4ai and eif-4aii in a 4:1 ratio, respectively, whereas the free form of rabbit eif-4a is composed solely of eif-4ai. using sucrose gradient centrifugation and an m7gtp-sepharose 4b assay, it was shown that eif-4a exchanges with the p46 subunit of eif-4f. incubation of [14c]eif-4a and eif-4f resulted in the incorporation of [14c] eif-4a into the eif-4f ...19938449919
interleukin-1 beta-specific partial agonists defined by site-directed mutagenesis studies.monocyte-derived interleukin 1 (il-1) mediates a wide range of biological effects including destruction of the cartilage matrix in articular diseases such as rheumatoid and osteoarthritis. to elucidate further the relationships between protein structure and biological activities, we have analyzed the sequence of several il-1 polypeptides using the algorithm of parker, the hydrophobic cluster analysis method and published structural data. this led us to identify several residues that seemed to be ...19938436117
processing of the dengue virus type 2 proteins prm and c-prm.a glycoprotein c-prm of 35,000 m(r) was immuno-precipitated from lysates of aedes albopictus cells infected with dengue virus type 2 (den-2) using antisera directed against the c protein or an amino-terminal fragment of the prm glycoprotein. c-prm was not detected in infected vero cells. the prm glycoprotein synthesized in infected a. albopictus and vero cells was cleaved to produce the membrane-associated virion protein (m) and the non-m fragment (pr) immediately preceding or occurring simultan ...19938429301
[comparative studies of acid-base and gas metabolism in the whole blood and erythrocytes in endotoxic shock in rabbits].parameters of acid-base and gas metabolism in whole blood and in red cell hemolysate were determined 30, 60 and 120 minutes after inducing endotoxin shock in rabbits of belgian giant breed. astrup's micromethod on apparatus of the firm "radiometer" was used. endotoxin shock was induced by intravenous injection of 2 mg/kg endotoxin from e. coli 0111:b4 strain. equations were used for expressing the relation between ph of erythrocytes and ph of whole blood and analysis made of the correlation betw ...19938411860
r plasmid in escherichia coli o103 coding for colonization of the rabbit intestinal tract. 19938406848
expression and characterization of the eaea gene product of escherichia coli serotype o157:h7.in enteropathogenic escherichia coli, the eaea gene produces a 94-kda outer membrane protein called intimin which has been shown to be necessary but not sufficient to produce the attaching-and-effacing lesion. the purpose of this study was to characterize the intimin specified by the eaea allele of the enterohemorrhagic e. coli (ehec) serotype o157:h7 strain cl8 and to determine its role in adherence. the carboxyl-terminal 266 amino acids of the cl8 intimin were expressed as a protein fusion wit ...19938406796
cloning, characterization and overexpression of a streptococcus pyogenes gene encoding a new type of mitogenic factor.a new type of mitogenic factor, termed mf, has been found in the culture supernatant of streptococcus pyogenes and its n-terminal amino acid sequence has been determined. on the basis of this sequence, an s. pyogenes gene encoding mf was cloned and its nucleotide sequence was determined. the mf gene includes a long, open reading frame with 813 nucleotides capable of encoding the mf precursor protein with 271 amino acids. removal of the putative 43 residues as a signal peptide results in the matu ...19938405402
mammalian polypeptide chain release factor and tryptophanyl-trna synthetase are distinct proteins.a very high (approximately 90%) structural similarity exists between the bovine, human and murine tryptophanyl-trna synthetases (wrs), and quite unexpectedly the rabbit polypeptide chain release factor (erf). this similarity may point to a very close resemblance or identity between these proteins involved in distinct steps of protein synthesis, or inadvertently to an incorrect assignment of the clone reported to encode erf, since the structure of clones encoding wrs were confirmed by peptide seq ...19938404867
glycogen-bound protein in lower eukaryote and prokaryote.the proteoglycogen fraction of neurospora crassa was purified and subjected to radioiodination with [125i]iodide. amylolysis of the polysaccharide moiety led to the isolation of a labelled 31 kda-protein. the nh2-terminal amino acid sequence of 10 residues of the 31 kda-protein was determined. a 31 kda-protein was also bound to glycogen in escherichia coli. proteoglycogen has not been heretofore found in any primitive unicellular organism.19938401303
two regions of the herpes simplex virus type 1 ul42 protein are required for its functional interaction with the viral dna polymerase.two essential gene products of herpes simplex virus type 1, the viral dna polymerase (pol) and ul42, its accessory protein, physically and functionally interact to form the core of the viral dna replication complex. understanding this essential interaction would provide a basis from which to develop novel anti-herpesvirus agents. we previously have shown that when coexpressed in an in vitro transcription-translation system, ul42 stimulates pol activity (m. l. gallo, d. i. dorsky, c. s. crumpacke ...19938396660
the e. coli envy gene encodes a high affinity opioid binding site.in an attempt to isolate a cdna encoding an opioid receptor, a cdna library was constructed in the lambda zap vector using ng108-15 mrna as template. using an in vitro transcription-translation assay and a sib selection strategy, a single phage was isolated. an rna transcribed from this cdna was able to direct in vitro translation of opioid binding sites. the insert was sequenced and comparison with data banks showed a 100% homology with the e. coli envy gene. we assume that the presence of the ...19938396214
enteroaggregative escherichia coli heat-stable enterotoxin 1 represents another subfamily of e. coli heat-stable toxin.enteroaggregative escherichia coli (eaggec) are associated with persistent diarrhea in young children. some of these organisms produce a low-molecular-weight, heat-stable, plasmid-encoded enterotoxin that has been named eaggec heat-stable enterotoxin 1 (east1). we have cloned a 4.4-kb dna fragment from the virulence plasmid of prototype eaggec strain 17-2, which expresses enterotoxic activity as measured by electrogenic response in ussing chambers mounted with rabbit ileal tissue. dna-sequence a ...19938385356
purification and characterization of recombinant-expressed cytochrome p450 2c3 from escherichia coli: 2c3 encodes the 6 beta-hydroxylase deficient form of p450 3b.rabbit cytochrome p450 2c3 was expressed from its cdna in escherichia coli as a chimeric enzyme in which a portion of the n-terminal membrane anchor sequence of 2c3 was replaced with a modified sequence derived from p450 17 alpha. the nucleotide sequence encoding the n-terminus of p450 17 alpha was modified previously to achieve a high level of expression of p450 17 alpha in e. coli by altering the first eight codons of p450 17 alpha to reflect second codon preferences for high expression and to ...19938380971
nebulin as an actin zipper. a two-module nebulin fragment promotes actin nucleation and stabilizes actin filaments.nebulin is a family of giant muscle proteins (700-900 kda) that interact with actin to form composite thin filaments in the skeletal muscle sarcomere. this modular protein is composed predominantly of repeating sequence modules of 31-38 residues. to understand the minimum size and number of sequence modules that are required for actin interaction, we studied the behavior of a highly soluble two-module nebulin fragment nd8 that was expressed in escherichia coli. by fluorescence spectroscopy with ...19938376391
cdna cloning and characterization of the protein encoded by rd, a gene located in the class iii region of the human major histocompatibility complex.the rd gene, initially defined in the mouse, has been mapped between the bf and c4a genes in the human major histocompatibility complex class iii region. using the mouse cdna as a probe, we isolated and sequenced human rd cdna clones. the composite nucleotide sequence consisted of 1301 nucleotides, excluding a poly(a) tail at the 3' end. it contained a single open reading frame encoding a polypeptide of 380 amino acid residues with a calculated molecular mass of 42274 da. the most striking struc ...19938373374
myristoylation of hippocalcin is linked to its calcium-dependent membrane association properties.hippocalcin, a recently identified ca(2+)-binding protein of the recoverin family exclusively expressed in the hippocampus, has a primary structure containing three putative ca(2+)-binding sites (ef-hands) and a possible nh2-terminal myristoylation site. 45ca blots demonstrated that every three ef-hand domains, expressed as fusion proteins in escherichia coli, bind ca2+, indicating that hippocalcin binds 3 mol of ca2+/mol of protein. to determine whether hippocalcin is myristoylated, hippocalcin ...19938360179
functional aspects of eicosanoid hydroxylation by lung and kidney cytochromes p450. expression of cdnas in mammalian cells and e. coli.a gene subfamily of cytochromes p450 with catalytic activity toward various eicosanoid substrates has been studied with a variety of techniques in this laboratory, including purification and characterization, localization at the tissue and subcellular levels, physiological function, and cloning and expression in prokaryotic and eukaryotic systems. this paper reports experiments directed toward determining the function of the cytochrome p4504a metabolite, 20-hydroxyarachidonic acid (20-hydroxyeic ...19938357994
adenoviral-mediated gene transfer to rabbit synovium in vivo.currently, treatment for rheumatoid arthritis and other inflammatory arthropathies is often ineffective in ameliorating the progression of the disease, particularly the invasive destruction of cartilage and bone by rheumatoid synovium. multiple aspects of this inflammatory process are mediated by the synovial lining cells (synoviocytes). genetic modification of these cells in vivo represents a potential method for the treatment of these conditions. in this report, we describe a novel technique f ...19938349791
antigen detection and immunological typing of haemophilus ducreyi with a specific rabbit polyclonal serum.a rabbit polyclonal serum was raised against the 29-kda species-specific marker, as well as the 30- to 34-kda immunotype-specific markers of haemophilus ducreyi described elsewhere (e. roggen, s. de breucker, e. van dyck, and p. piot, infect. immun. 60:590-595, 1992). these antigens were purified from a cocktail of h. ducreyi isolates by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. the immune serum reacted in enzyme-linked immunosorbent assay (elisa) preferentially with h. ducreyi, ...19938349759
isolation and heterologous expression of cloned cdnas for two rabbit nasal microsomal proteins, cyp2a10 and cyp2a11, that are related to nasal microsomal cytochrome p450 form a.nasal microsomal p450 form a (nma), a major cytochrome p450 isozyme in rabbit olfactory and respiratory nasal mucosa with high activity toward a variety of odorants and environmental toxicants, was previously purified to electrophoretic homogeneity from rabbit nasal microsomes. in the present study, a cdna library constructed from poly(a)+ rna from rabbit respiratory nasal mucosa was screened with antibodies to p450 nma, and five immunopositive clones were isolated and characterized. sequence an ...19938349611
[protein translocation across membranes]. 19938337387
fluorescence study of a temperature-induced conversion from the "loose" to the "tight" binding form of membrane-bound cytochrome b5.cytochrome b5 is a liver integral membrane protein that has now been expressed in, and isolated from, escherichia coli. the structure-function relationships of the 43 amino acid membrane-binding domain (nonpolar peptide) have been examined in both native and mutant forms of the protein; in the latter, tryptophan residues at positions 108 and 112 were replaced by leucine. the temperature dependence of the fluorescence quantum yield of the trp residues in the isolated membrane-binding domain was e ...19938334124
interleukin-1 receptor antibody (il-1rab) protection and treatment against lethal endotoxemia in mice.interleukin-1 (il-1) is a mediator of endotoxin shock and il-1 receptor blockade has been shown to have therapeutic efficacy against endotoxic shock and sepsis in laboratory models. the current studies were designed to characterize the efficacy of a murine monoclonal il-1 receptor antibody (il-1rab) against endotoxin (lps) lethality and to investigate whether combined anticytokine therapy using the il-1rab and a highly specific polyclonal rabbit anti-mouse tnf antibody (tnf ab) could provide add ...19938331925
hybrid enzymes for structure-function analysis of cytochrome p-450 2b11.previous work has shown that p-450 2b11 is responsible for the unique ability of dogs to metabolize and eliminate certain highly-chlorinated biphenyls such as 2,2',4,4',5,5'-hexachlorobiphenyl (245-hcb), whereas the related p-450 2b forms in rat and rabbit are unable to metabolize the compound to any significant degree. to determine the structural basis for this functional diversity, hybrid enzymes were generated. success with this approach required a careful choice of second enzyme and common s ...19938329443
intravitreal flomoxef sodium in rabbits.we studied the intraocular concentration of flomoxef sodium in nonvitrectomized and vitrectomized eyes of albino rabbits after intravenous administration of 100 mg/kg flomoxef sodium. the concentration of flomoxef sodium in the vitreous body was undetectable (< 0.1 micrograms/ml) in nonvitrectomized eyes. retinal toxicity of flomoxef sodium was investigated with ophthalmoscopy, electroretinography (erg) and light microscopy after intravitreal injection of 200, 500, 1,000 and 2,000 micrograms flo ...19938321517
Displaying items 901 - 1000 of 2435