Publications
| Title | Abstract | Year Filter | PMID(sorted ascending) Filter |
|---|
| seasonal variations of heavy metals in some organs of carp (cyprinus carpio l., 1758) from beyşehir lake (turkey). | in this study which was carried out between march 2003 and february 2005 fe, cu, zn, mn, cr, pb and cd contents were determined in muscle, liver and gill of carp (cyprinus carpio l., 1758) caught from beyşehir lake. among the heavy metals analyzed cr, pb and cd were below the detection limit (<0.03). heavy metal concentrations varied significantly depending on the type of the tissue and season. the highest metal concentrations were found in the liver, followed by gill and muscle. heavy metal lev ... | 2008 | 17503200 |
| carbonic anhydrases as drug targets--an overview. | at least 15 different alpha-carbonic anhydrase (ca, ec 4.2.1.1) isoforms were isolated in mammals, where these zinc enzymes play crucial physiological roles. some of these isozymes are cytosolic (ca i, ca ii, ca iii, ca vii, ca xiii), others are membrane-bound (ca iv, ca ix, ca xii, ca xiv and ca xv), ca va and ca vb are mitochondrial, and ca vi is secreted in saliva and milk. three acatalytic forms are also known, the ca related proteins (carp), carp viii, carp x and carp xi. representatives of ... | 2007 | 17504127 |
| the formation of the polyploid hybrids from different subfamily fish crossings and its evolutionary significance. | this study provides genetic evidences at the chromosome, dna content, dna fragment and sequence, and morphological levels to support the successful establishment of the polyploid hybrids of red crucian carp x blunt snout bream, which belonged to a different subfamily of fish (cyprininae subfamily and cultrinae subfamily) in the catalog. we successfully obtained the sterile triploid hybrids and bisexual fertile tetraploid hybrids of red crucian carp (rcc) (female symbol) x blunt snout bream (bsb) ... | 2007 | 17507678 |
| the effects of anticoagulants on hematological indices and blood cell morphology of common carp (cyprinus carpio l.). | hematological parameters (ht, hb, rbc, wbc, plt), erythrocyte size, and osmotic fragility, differential leukocyte count, ros production in common carp blood collected on three anticoagulants: heparin (10 iu/ml, na2edta (0.1, 0.5, and 1 mg/ml), and sodium citrate (0.3 mg/ml) were compared. na2edta caused partial blood hemolysis in ht tubes which made ht measurement impossible, and resulted in high variability of the results. both, citrate and na2edta increased sensitivity of red blood cells to he ... | 2007 | 17509941 |
| transactivator of transcription-tagged cell cycle and apoptosis regulatory protein-1 peptides suppress the growth of human breast cancer cells in vitro and in vivo. | deregulated signaling by the epidermal growth factor receptor family of proteins is encountered in human malignancies including breast cancer. cell cycle and apoptosis-regulatory protein-1 (carp-1), a novel, perinuclear phosphoprotein, is a regulator of apoptosis signaling by epidermal growth factor receptors. carp-1 expression is diminished in human breast cancers, and correlates inversely with human breast cancer grades which could be attributed to increased methylation. the expression of carp ... | 2007 | 17513614 |
| direct evidence for interaction between lead ions and kidney dna from silver crucian carp. | a direct interaction of lead (pb) with kidney dna from silver crucian carp (carassius auratus gibelio) has been systematically studied in vitro using multi-techniques, including uv-vis absorption, extended x-ray absorption fine structure, vacuum ultraviolet circular dichroism spectral methods and gel electrophoresis. we find that pb is bound with four oxygen or nitrogen atoms of dna in its fresh shell at the distances of 2.64 a. additionally, pb may bind to the oxygen atom of nucleic acid or nit ... | 2007 | 17517428 |
| the fine structural organization of the olfactory epithelium of cyprinus carpio (linnaeus): a scanning electron microscopic study. | the fine anatomical structures of the olfactory epithelium of cyprinus carpio (linnaeus) have been systematically studied with the help of the scanning electron microscope (sem). the olfactory rosette is an oval structure composed of a number of lamellae arranged on a median raphe. a large part of the lateral surface of the rosette is covered with non-receptor epithelium, whereas the receptor epithelium occupies a much smaller area in the middle part. the nonreceptor epithelium is covered with a ... | 2007 | 17533588 |
| corticotropin-releasing factor (crf) and crf-binding protein expression in and release from the head kidney of common carp: evolutionary conservation of the adrenal crf system. | corticotropin-releasing factor (crf) plays a central role in the regulation of the stress axis. in mammals, crf as well as its receptors and its crf-binding protein (crf-bp) are expressed in a variety of organs and tissues outside the central nervous system. one of these extrahypothalamic sites is the adrenal gland, where the paracrine actions of adrenal crf influence cortical steroidogenesis and adrenal blood flow. although the central role of crf signaling in the initiation and regulation of t ... | 2007 | 17535873 |
| evidence for maternal inheritance of mitochondrial dna in allotetraploid. | the complete mitochondrial dna (mtdna) sequences of the allotetraploid and red crucian carp were determined in this paper. we compared the complete mtdna sequences between the allotetraploid and its female parent red crucian carp, and between the allotetraploid and its male parent common carp. the results indicated that the complete mtdna nucleotide identity (99.7%) between the allotetraploid and its female parent red crucian carp was higher than that (89.0%) between the allotetraploid and its m ... | 2007 | 17541829 |
| [3h] muscimol receptors sites in the carp (cyprinus carpio l.) brain: binding assay and autoradiographic distribution. | autoradiographic and binding techniques were used to study the presence of [(3)h]muscimol receptors sites in the carp brain. the radioligand was distributed with an high degree of anatomical selectivity. we found abundant labelling in the cerebellum, in the nucleus diffusus lobi inferioris, and in the torus longitudinalis. no labelling was detected within the epithalamus, thalamus and hypothalamus, while the telencephalon and the rhombencephalon displayed a low density of [(3)h]muscimol receptor ... | 2007 | 17553715 |
| morphological and genetic differences of trypanosoma in some chinese freshwater fishes: difficulties of species identification. | blood smears and purified trypanosome from freshwater fishes yellow catfish (pseudobagras fulvidraco) and common carp (cyprinus carpio) captured from niushan lake, hubei province were examined to determine whether all of their trypanosomes were trypanosoma pseudobagri, a species of supposed host specificity and widespread existence across china. trypanosomes occurred in 16/16 blood smears, and morphometric character analysis of trypanosomes from these smears showed that there were three morphosp ... | 2007 | 17558522 |
| kinematics, hydrodynamics and energetic advantages of burst-and-coast swimming of koi carps (cyprinus carpio koi). | koi carps frequently swim in burst-and-coast style, which consists of a burst phase and a coast phase. we quantify the swimming kinematics and the flow patterns generated by the carps in burst-and-coast swimming. in the burst phase, the carps burst in two modes: in the first, the tail beats for at least one cycle (multiple tail-beat mode); in the second, the tail beats for only a half-cycle (half tail-beat mode). the carp generates a vortex ring in each half-cycle beat. the vortex rings generate ... | 2007 | 17562892 |
| comparison of the uptake of polycyclic aromatic hydrocarbons and organochlorine pesticides by semipermeable membrane devices and caged fish (carassius carassius) in taihu lake, china. | uptake of polycyclic aromatic hydrocarbons (pahs) and organochlorine pesticides (ocps) by triolein-containing semipermeable membrane devices (spmds) and by crucian carp (carassius carassius) was studied in taihu lake, a shallow, freshwater lake in china. crucian carp and spmds were deployed side by side for 32 d. the first-order uptake rate constants of individual pahs and ocps for the two matrices were calculated and compared to relate the amounts of chemicals accumulated by the matrices to dis ... | 2007 | 17571693 |
| sequential ultrastructural and biochemical changes induced in vivo by the hepatotoxic microcystins in liver of the phytoplanktivorous silver carp hypophthalmichthys molitrix. | up to now, in vivo studies on the toxic effects of microcystins (mcs) on the ultrastructures of fish liver have been very limited. the phytoplanktivorous silver carp was injected i.p. with extracted hepatotoxic microcystins (mainly mc-rr and -lr) at a dose of 1000 microg mc-lreq. kg(-1) body weight, showing a time-dependent ultrastructural change in liver as well as significant increases in enzyme activity of plasma alanine aminotransferase (alt), aspartate aminotransferase (ast) and lactate deh ... | 2007 | 17574927 |
| functional characterisation of ucp1 in the common carp: uncoupling activity in liver mitochondria and cold-induced expression in the brain. | mammalian uncoupling protein 1 (ucp1) mediates nonshivering thermogenesis in brown adipose tissue. we previously reported on the presence of a ucp1 orthologue in ectothermic fish and observed downregulation of ucp1 gene expression in the liver of the common carp. neither the function of ucp1, nor the mode of ucp1 activation is known in carp liver mitochondria. here, we compared the proton conductance at 25 degrees c of liver mitochondria isolated from carp either maintained at 20 degrees c (warm ... | 2007 | 17576568 |
| carp versus cranium: a fishy story. | issues of drowning or near drowning in aquatic sporting have received considerable attention in the literature; however, there is not a lot of attention to nonsubmersion injuries such as water tubing. water tubing is similar to water skiing but with much less control by the rider, leaving the rider at the mercy of the driver or any obstacle in their path. this report describes unusual events surrounding the injury of a 5-year-old boy enjoying water fun with his father on his boat. the importance ... | 2007 | 17579328 |
| ecotoxicological assessment of water pollution in sariyar dam lake, turkey. | given the effects of environmental pollution and different biotic factors on some important biochemical markers, as enzymes, two fish species inhabiting the sariyar dam lake, turkey have been investigated. ethoxyresorufin o-deethylase, glutathion s-transferase, lactate dehydrogenase, alkaline phosphatase, acid phosphatase, and alanine and aspartate amino transferase activities have been measured in liver samples of cyprinus carpio and capoeta tinca. also, brain acetylcholinesterase and carboxyle ... | 2008 | 17582495 |
| carp (cyprinus carpio) vitellogenin: characterization of yolk proteins, development of immunoassays and use as biomarker of exposure to environmental estrogens. | the precursor protein of egg yolk, vitellogenin (vg), is cleaved into three major components (lipovitellin, phosvitin and beta'-component) at the time of incorporation by growing oocytes. we purified three yolk proteins (yp1, yp2 and yp3) from ovaries of the common carp (cyprinus carpio) by a combined method of ammonium sulfate precipitation and column chromatography. biochemical analyses of the purified proteins of this species suggest that yp1, yp2 and yp3 are lipovitellin, beta'-component and ... | 2007 | 17585296 |
| the complete mitochondrial genome of the chinese hook snout carp opsariichthys bidens (actinopterygii: cypriniformes) and an alternative pattern of mitogenomic evolution in vertebrate. | the complete mitochondrial genome sequence of the chinese hook snout carp, opsariichthys bidens, was newly determined using the long and accurate polymerase chain reaction method. the 16,611-nucleotide mitogenome contains 13 protein-coding genes, two rrna genes (12s, 16s), 22 trna genes, and a noncoding control region. we use these data and homologous sequence data from multiple other ostariophysan fishes in a phylogenetic evaluation to test hypothesis pertaining to codon usage pattern of o. bid ... | 2007 | 17587513 |
| the nuclear phenotypic plasticity observed in fish during rrna regulation entails cajal bodies dynamics. | cajal bodies (cbs) are small mobile organelles found throughout the nucleoplasm of animal and plant cells. the dynamics of these organelles involves interactions with the nucleolus. the later has been found to play a substantial role in the compensatory response that evolved in eurythermal fish to adapt to the cyclic seasonal habitat changes, i.e., temperature and photoperiod. contrary to being constitutive, rrna synthesis is dramatically regulated between summer and winter, thus affecting ribos ... | 2007 | 17588531 |
| [the effects of parasites on the growth of the crucian carp (carassius carassius l., 1758) inhabiting the kovada lake]. | the aim of this study carried out between march 2003-february 2004 was to determine the effects of parasites on the growth of the crucian carp (carassius carassius l., 1758) inhabiting the kovada lake. a total of 102 specimens were caught monthly and investigated parasitologically. the age distribution of these fish were found to be between 3-7 years and 54 (52.9%) were infected by the various parasites. investigations of fish that were caught during the same month of the same sex and of the sam ... | 2007 | 17594663 |
| gill remodeling in fish--a new fashion or an ancient secret? | while a large respiratory surface area is good for gas exchange, it also poses several problems, including energetically unfavorable fluxes of water and ions. as a result, fishes appear to have a respiratory surface area that is matched to their oxygen demands. when faced with changes in their need for oxygen uptake, e.g. through altered physical activity or altered ambient oxygen levels, fishes have long been known to make two different adjustments: (1) to change the water flow over the gills o ... | 2007 | 17601943 |
| actin filament organization of foot processes in vertebrate glomerular podocytes. | we investigated the actin filament organization and immunolocalization of actin-binding proteins (alpha-actinin and cortactin) in the podocyte foot processes of eight vertebrate species (lamprey, carp, newt, frog, gecko, turtle, quail, and rat). three types of actin cytoskeleton were found in these foot processes. (1) a cortical actin network with cortactin filling the space between the plasma membrane and the other actin cytoskeletons described below was found in all of the species examined her ... | 2007 | 17605050 |
| on the role of nr3a in human nmda receptors. | in the present paper we describe our on-going project investigating the functional roles of the n-methyl-d-aspartate (nmda) receptor subunit nr3a. we find that nr3a mrna is abundant both in embryonic and adult human brain, in contrast to the almost non-existing expression in adult rodent brain. human nr3a (hnr3a) protein expression is particularly abundant in the cerebral cortex, as shown by western blot using nr3a-specific antibodies. distribution of hnr3a in adult human brain shows a similar p ... | 2007 | 17617428 |
| a comparative study on innate immune parameters in the epidermal mucus of various fish species. | fish epidermal mucus and its components provide the first line of defense against pathogens. little is known about the role of epidermal mucus enzymes in the innate immune system of fish species such as arctic char (salvelinus alpinus), brook trout (s. fontinalis), koi carp(cyprinus carpio), striped bass (morone saxatilis), haddock, (melanogrammus aeglefinus), atlantic cod (gadus morhua) and hagfish (myxine glutinosa). the epidermal mucus samples from these fish were analysed for the specific ac ... | 2007 | 17618153 |
| acute toxicity of antimony chloride and its effects on oxygen consumption of common carp (cyprinus carpio). | the purposes of this study were to investigate the acute toxicity and effects of sublethal antimony (sb) concentrations on respiratory activity changes in the common carp (cyprinus carpio). median lethal concentrations were determined in acute tests. the 96-h lc50 value was 14.05 (11.09~17.80) mg l(-1). common carp were exposed to 4 different sublethal levels of antimony (1.0, 2.0, 4.0, and 8.0 mg l(-1)) over a 28-day test period and a 14-day recovery period. on days 14 and 28, decreases in oxyg ... | 2007 | 17618378 |
| prevalence of fishborne zoonotic parasites in important cultured fish species in the mekong delta, vietnam. | a seasonal investigation on the occurrence of fishborne zoonotic trematodes (fzt) in economically important mono-cultured hybrid catfish and giant gouramy was conducted in the mekong delta of vietnam. fish from carp poly-culture and intensive small-scale integrated vegetable-aquaculture-animal husbandry farming (vac) systems were also examined. no fzt metacercariae were found in any mono-cultured hybrid catfish. fzt metacercariae were common, however, in fish from the other three systems: all me ... | 2007 | 17618460 |
| global cooling: cold acclimation and the expression of soluble proteins in carp skeletal muscle. | the common carp (cyprinus carpio) has a well-developed capacity to modify muscle properties in response to changes in temperature. understanding the mechanisms underpinning this phenotypic response at the protein level may provide fundamental insights into the molecular basis of adaptive processes in skeletal muscle. in this study, common carp were subjected to a cooling regimen and soluble extracts of muscle homogenates were separated by 1-d sds-page and 2-de. proteins were identified using mal ... | 2007 | 17623276 |
| molecular cloning and expression analysis of t-bet in ginbuna crucian carp (carassius auratus langsdorfii). | in the adaptive immune system of mammals, naive helper t (th) cells differentiate into th1 or th2 cells. the t-box expressed in t cells (t-bet) is a member of a family of t-box transcription factors that regulates the expression of ifn-gamma and plays a crucial role in th1 cell differentiation and cell-mediated immunity. we cloned and sequenced t-bet cdna for the first time from non-mammalian species, ginbuna crucian carp. ginbuna t-bet was composed of 608 predicted amino acids and showed 41.5% ... | 2008 | 17624433 |
| the toxicity of copper to crucian carp (carassius carassius) in soft water. | crucian carp (carassius carassius) were exposed to a cu rich medium (ph 6.6, conductivity 25 micros/cm, 2.91 mg ca(2+)/l, approximately 300 microg cu(2+)/l). untreated department water (ph 6.6, conductivity 25 micros/cm, 2.91 mg ca(2+)/l) acted as control. mortality in crucian carp was first observed after 13 days of exposure to the cu rich medium. there were, however, significant changes in haematocrit, plasma chloride, plasma sodium and water content in muscle in fish exposed to the cu rich me ... | 2007 | 17628637 |
| debromination of polybrominated diphenyl ether-99 (bde-99) in carp (cyprinus carpio) microflora and microsomes. | based on previous findings in dietary studies with carp (cyprinus carpio), we investigated the mechanism of 2,2',4,4',5-pentabromodiphenyl ether (bde-99) debromination to 2,2',4,4'-tetrabromodiphenyl ether (bde-47) using liver and intestinal components. in vitro aerobic and anaerobic experiments tested the ability of carp intestinal microflora to debrominate bde-99. no debromination of bde-99 to bde-47 was observed in microfloral samples; therefore, carp enzymatic pathways were assessed for debr ... | 2007 | 17640709 |
| presence and inducibility by beta-naphthoflavone of cyp1a1, cyp1b1 and phase ii enzymes in trematomus bernacchii, an antarctic fish. | this study investigated some aspects of xenobiotic metabolism in the nototheniidae trematomus bernacchii, a key sentinel species for monitoring antarctic ecosystems. after laboratory exposure to beta-naphthoflavone (betanf), basal levels and time-course induction of cyp1a, cyp1b and cyp3a were measured as enzymatic activities, immunoreactive protein content and mrna expression in liver, gills, intestine and heart. additional analyses in the liver included enzymatic activities of testosterone hyd ... | 2007 | 17643506 |
| studies on resistance characteristic and cdna sequence conservation of transferrin from crucian carp, carassius auratus. | transferrin (tf) is a kind of non-heme beta-globulin with two iron ions (fe(3+))-binding sites. to prove tf's physiological functions, fe(3+)-proteins, serum iron contents, and total iron-binding capabilities were tested for tfs of crucian carps (carassius auratus) and sliver carps (hypophthalmichthys molitrix). the above results demonstrated that sliver carps shared 1/3 tf alleles with crucian carps; tf of crucian carps had stronger fe(3+)-binding ability and transportation ability in plasma th ... | 2007 | 17646932 |
| [analysis of genetic diversity among silver carp populations in the middle and lower yangtse river using thirty microsatellite markers]. | thirty microsatellite markers were used to analyze the genetic diversity of five silver carp populations in the middle and lower reaches of the yangtze river. a total of 144 different alleles were found and the number of alleles in each locus ranged from 1 to 10. twenty-five loci (83.33%) were polymorphic. in the five populations, the average number of alleles was 4.0 to 4.1, the number of mean valid alleles was 2.4445 to 2.6332, the value of average observed and expected heterozygosity ranged f ... | 2007 | 17650488 |
| genome-wide mapping of modifier chromosomal loci for human hypertrophic cardiomyopathy. | hypertrophic cardiomyopathy (hcm) is a disease of mutant sarcomeric proteins (except for phenocopy). cardiac hypertrophy is the clinical diagnostic hallmark of hcm and a major determinant of morbidity and mortality in various cardiovascular diseases. however, there is remarkable variability in expression of hypertrophy, even among hcm patients with identical causal mutations. we hypothesized modifier genes are partly responsible for the variation in hypertrophic expressivity. to map the modifier ... | 2007 | 17652099 |
| using semipermeable membrane devices, bioassays, and chemical analysis for evaluation of bioavailable polycyclic aromatic hydrocarbons in water. | meiliang bay is a sublake of taihu lake and has been polluted by domestic and industrial effluents. as part of a comprehensive risk assessment project in this region, semipermeable membrane devices (spmds) were applied to evaluate the levels and potential toxic potency of polycyclic aromatic hydrocarbons (pahs) in lakewater, in combination with chemical analysis and in vitro bioassay using h4iie rat hepatoma cells. in addition, induction of hepatic ethoxyresorufin-o-deethylase (erod) activity, i ... | 2007 | 17657463 |
| linking human nutrition and fisheries: incorporating micronutrient-dense, small indigenous fish species in carp polyculture production in bangladesh. | fish and fisheries are important for the livelihoods, food, and income of the rural population in bangladesh. increased rice production and changing agricultural patterns have resulted in a large decline in inland fisheries. implementation of carp pond polyculture has been very successful, whereas little focus has been given to the commonly consumed small indigenous fish species, some of which are rich in vitamin a and minerals, such as calcium, iron, and zinc, and are an integral part of the ru ... | 2007 | 17658074 |
| differential transcription of multiple forms of alpha-2-macroglobulin in carp (cyprinus carpio) infected with parasites. | alpha-2-macroglobulin (a2m) is a non-specific protease inhibitor involved in host defense mechanisms, inhibiting both endogenous and exogenous proteases. it is unique among the plasma anti-proteases with respect to the diversity of proteases that it can inactivate. carp a2m consists of an alpha and beta chain of which the first includes the bioactive regions. previously, three a2m alpha chain sequences were reported for east-asian common carp. we studied a2m alpha chain variability in european c ... | 2008 | 17662386 |
| the effects of three organic chemicals on the upper thermal tolerances of four freshwater fishes. | the upper temperature tolerance limits of four freshwater fish species, silver perch bidyanus bidyanus, eastern rainbowfish melanotaenia duboulayi, western carp gudgeon hypseleotris klunzingeri, and rainbow trout oncorhynchus mykiss, were determined using the critical thermal maximum (ctmaximum) method. the ctmaximum tests were carried out with unexposed fish and fish exposed to sublethal concentrations of endosulfan, chlorpyrifos, and phenol to determine whether or not the ctmaximum was affecte ... | 2007 | 17665686 |
| the effect of food rations on tissue-specific copper accumulation patterns of sublethal waterborne exposure in cyprinus carpio. | common carp (cyprinus carpio) were fed to two different food rations, 0.5% body weight (low ration [lr]) and 5% body weight (high ration [hr]), and were exposed to sublethal (1 microm) copper levels for 28 d in softened antwerp (belgium) city tap water (ca2+, 79.3 mg/l; mg2+, 7.4 mg/l; na+, 27.8 mg/l; ph 7.5-8.0). copper accumulations in the liver, gills, kidney, anterior intestine, posterior intestine, and muscle were determined. copper accumulation in the gills, liver, and kidney of lr fish wa ... | 2007 | 17665693 |
| altered serum levels of sex steroids and biotransformation enzyme activities by long-term alachlor exposure in crucian carp (carassius auratus). | 2007 | 17668140 | |
| microbiological quality of fish grown in wastewater-fed and non-wastewater-fed fishponds in hanoi, vietnam: influence of hygiene practices in local retail markets. | mean water quality in two wastewater-fed ponds and one non-wastewater-fed pond in hanoi, vietnam was approximately 10(6) and approximately 10(4) presumptive thermotolerant coliforms (pthc) per 100 ml, respectively. fish (common carp, silver carp and nile tilapia) grown in these ponds were sampled at harvest and in local retail markets. bacteriological examination of the fish sampled at harvest from both types of pond showed that they were of very good quality (2 - 3 pthc g(-1) fresh muscle weigh ... | 2007 | 17674570 |
| nationwide study of dioxins in the freshwater fish carassius auratus (gibelio) langsdorfii (crucian carp) in japan: concentrations and estimation of source contribution ratios. | we investigated dioxin concentrations in freshwater fish in japan by standardizing species to detect subtle decreasing trends of dioxin concentrations in the future with the reinforcement of regulations. the fish studied were crucian carp (carassius auratus (gibelio) langsdorfii), an omnivorous species. fish and sediments were collected from 14 rivers and lakes located in remote areas, agricultural areas, and small and large cities throughout japan. the total toxic equivalent (teq) dioxin concen ... | 2007 | 17675214 |
| isolation and characterization of alpha1-proteinase inhibitor from common carp (cyprinus carpio) seminal plasma. | using a three-step procedure, we purified (79 and 51.6-fold to homogeneity) and characterized the two isoforms (a and b) of alpha1-proteinase inhibitor-like protein from carp seminal plasma. the isoforms have molecular masses of 55.5 and 54.0 kda, respectively. these inhibitors formed sds-stable complexes with cod and bovine trypsin, chymotrypsin and elastase. the thirty-three amino acids within the reactive loop slpdtvilnrpflvlivedttksilfmgkitnp were identified for isoform b. the same first ten ... | 2007 | 17681818 |
| a progestin and an estrogen regulate early stages of oogenesis in fish. | using two species of teleost fish, japanese huchen (hucho perryi) and common carp (cyprinus carpio), we investigated whether sex steroids are involved in early oogenesis in vitro. ovarian fragments were cultured to examine the effects of a progestin, 17alpha, 20beta-dihydroxy-4-pregnen-3-one (dhp), and an estrogen, estradiol-17 beta (e2). dhp and e2 significantly promoted dna synthesis in ovarian germ cells, as judged by 5-bromo-2-deoxyuridine (brdu) incorporation into these cells. furthermore, ... | 2007 | 17687117 |
| action of ascorbic acid on a myosin molecule derived from carp. | the influence of l-ascorbic acid at 40 degrees c incubation on the subfragment-1 and rod regions, prepared by chymotryptic digestion of myosin, and myosin was investigated by sds-polyacrylamide gel electrophoresis and transmission electron microscopy respectively. it was observed that l-ascorbic acid acted more readily on the subfragment-1 region of myosin. further, circular dichroism measurement indicated that l-ascorbic acid did not affect the structure of myosin. these results suggest that l- ... | 2007 | 17690444 |
| melatonin in the regulation of annual testicular events in carp catla catla: evidence from the studies on the effects of exogenous melatonin, continuous light, and continuous darkness. | the physiological significance of melatonin in the regulation of annual testicular events in a major carp catla catla was evaluated through studies on the effects of graded dose (25, 50, or 100 microg/100 g body wt.) of melatonin exogenously administered for different durations (1, 15, or 30 days) and manipulation of the endogenous melatonin system by exposing the fish to constant darkness (dd) or constant light (ll) for 30 days. an identical experimental schedule was followed during the prepara ... | 2007 | 17701677 |
| the zebrafish erythropoietin: functional identification and biochemical characterization. | in the present study, the zebrafish epo cdna was cloned. the encoded protein displays 90%, 55% and 32% identity to the epo from carp, fugu and human, respectively. through rt-pcr, the expression of zepo mrna was mainly in the heart and liver. in the cos-1 cell transfection experiments, the recombinant zepo-ha protein was efficiently secreted into the culture medium as a glycoprotein and the carbohydrate moiety can be cleaved by the treatment of peptide-n-glycosidase f (pngase f). using the morph ... | 2007 | 17706649 |
| antiproliferative effects and apoptosis induction by probiotic cytoplasmic extracts in fish cell lines. | probiotic bacteria are known to exert a wide range of beneficial effects on their animal hosts. control of intestinal homeostasis, inflammation suppression and a reduction in the incidence of cancer all rely on the antiproliferative potential of probiotics. in this paper, we assess the antiproliferative activity of probiotics in two teleost fish cell lines saf-1, a fibroblast cell line and epc, an epithelioma from carp. cells were grown in the presence of cytoplasmic extracts obtained from two b ... | 2008 | 17706899 |
| cross-reactivity of human leukocyte differentiation antigen monoclonal antibodies on carp and rainbow trout cells. | three hundred and seventy-seven monoclonal antibodies (mabs) directed against human cd antigens and non-classified human leukocyte surface antigens were assayed for their reactivity with common carp (cyprinus carpio l.) and rainbow trout (oncorhynchus mykiss) peripheral blood leukocytes (pbl) and thymocytes within the animal homologue section of the 8th international workshop on human leukocyte differentiation antigens (hlda8). four of the mabs clearly reacted with rainbow trout pbl and two with ... | 2007 | 17707517 |
| maternal balanced translocation (4;21) leading to an offspring with partial duplication of 4q and 21q without phenotypic manifestations of down syndrome. | we describe an 8-years old female with supernumerary chromosome der(21)t(4;21)(q25;q22) resulting in partial trisomy 4q25-qter and partial trisomy 21(pter-q22). the extra material was originated from a reciprocal balanced translocation carrier mother (4q;21q). karyotyping was confirmed by fish using whole chromosome painting probes for 4 and 21q and using 21q22.13-q22.2 specific probe to rule out trisomy of down syndrome critical region. phenotypic and cytogenetic findings were compared with pre ... | 2007 | 17710874 |
| effects of ammonia, nitrite and nitrate on hemoglobin content and oxygen consumption of freshwater fish, cyprinus carpio (linnaeus). | lethal effects of nitrogenous compounds ammonia, nitrite and nitrate on freshwater fish cyprinus carpio were studied and the static lc50 values obtained for these 3 toxicants for 24 hr were 0.80 ppb, 171.36 ppm; 1075.10 ppm and continuous flowthrough lc50 values for 24 hr were 0.72 ppb, 154.31 ppm; 967.63 ppm respectively. the fish were exposed to lethal concentrations to study the changes in hematological parameters and the rate of oxygen consumption. during the period of exposure general decli ... | 2007 | 17717984 |
| combined effects of different food rations and sublethal copper exposure on growth and energy metabolism in common carp. | common carp (cyprinus carpio) were fed two different rations, 0.5% body weight (low ration; lr) and 5% body weight (high ration; hr), throughout acclimation, sublethal (64 microg/l) cu exposure for 28 days, and a subsequent 2-week recovery period. growth, liver water content, and liver energy stores were assessed during this period. growth rates were elevated in hr fish compared to lr fish, as was the hepatic lipid content. this was associated with a higher water content in the livers of lr fish ... | 2008 | 17721796 |
| [organization of olfactory system of the indian major carp labeo rohita (ham.): a study using scanning and transmission microscopy]. | catla catla, labeo rohita, and cirrhinus mrigala are important alimentary fish in india. their reproduction (breeding) depends on season. the fish perceive external factors-stimuli and chemical signals through the olfactory system that plays the key role in the central regulation of reproduction. however, in the available literature, any electron microscopy data on organization of olfactory elements in these fish are absent. we have studied ultrastructure of the olfactory organ in male l. rohita ... | 2007 | 17725034 |
| electrochemical measurement of hydrogen peroxide in plasma: evaluation of freshwater prawn (macrobrachium rosenbergii) and crucian carp (cyprinus carpio) phagocytes under natural conditions. | an electrochemical technique for the real-time detection of hydrogen peroxide (h2o2) was employed to describe respiratory burst activity (rba) of phagocytes in plasma which can be used to evaluate the ability of immune system and disease resistance. the method is based upon the electric current changes, by redox reaction on platinum electrode of extracellular hydrogen peroxide (h2o2) released from phagocytes stimulated by the zymosan at 680 mv direct current (d.c.). compared with the control, ac ... | 2007 | 17728150 |
| polymorphism of transferrin of carp seminal plasma: relationship to blood transferrin and sperm motility characteristics. | transferrin (tf) is a major protein of carp (cyprinus carpio) seminal plasma. its relationship with milt quality is unknown. in this study, we sought to determine if tf is polymorphic in carp seminal plasma and if this polymorphism is related to sperm motility characteristics. we screened males of purebred common carp line (polish line r6) for tf polymorphism in blood plasma. the majority of tf genotypes represented only dd and dg variants. we then collected milt from preselected dd and dg genot ... | 2007 | 17728166 |
| carp scrapped. | 1981 | 17755144 | |
| carp in ponds. | 1929 | 17758203 | |
| genotyping spring viraemia of carp virus and other piscine vesiculo-like viruses using reverse hybridisation. | a simple nylon membrane-based dna macroarray was developed to genotype spring viraemia of carp virus (svcv) and related viruses. twenty-six viruses were genotyped using the array, and the results were confirmed by phylogenetic analysis of a 426 bp partial glycoprotein gene sequence. the array was not only capable of discriminating between the 4 main genogroups of cyprinid vesiculo-type viruses described previously, but also accurately sub-type the svc viruses assigned to genogroup i. the assay o ... | 2007 | 17760389 |
| predator-induced phenotypical change in body morphology in crucian carp. | in a field experiment where the presence or absence of piscivorous pike (esox lucius) in ponds was manipulated, the morphology of crucian carp (carassius carassius) diverged, such that individuals became deeper bodied in pond sections with pike. a laboratory experiment confirmed that the presence of this predator induced a change in body morphology in the carp. estimation of prey vulnerability to predation by pike, a gape-limited predator, revealed that this increase in body depth resulted in cr ... | 1992 | 17778362 |
| temperature acclimation: improved sustained swimming performance in carp at low temperatures. | at low temperatures, the reduction in mechanical power output of the aerobic muscle forces cold-blooded animals, such as carp, to recruit their rapidly fatiguing anaerobic fibers at relatively slow swimming speeds. previous experimental data have suggested that changes in the biochemistry and morphology of the aerobic muscle during cold acclimation might increase its output of mechanical power. the present experiments show that, because of these changes, carp can swim faster at low temperature u ... | 1985 | 17779642 |
| phylogenetic analysis of spring virema of carp virus reveals distinct subgroups with common origins for recent isolates in north america and the uk. | genetic relationships between 35 spring viremia of carp virus (svcv) genogroup ia isolates were determined based on the nucleotide sequences of the phosphoprotein (p) gene and glycoprotein (g) genes. phylogenetic analysis based on p gene sequences revealed 2 distinct subgroups within svcv genogroup ia, designated svcv iai and iaii, and suggests at least 2 independent introductions of the virus into the usa in 2002. combined p- and g-sequence data support the emergence of svcv in illinois, usa, a ... | 2007 | 17803105 |
| structural and expression analyses of two vitellogenin genes in the carp, cyprinus carpio. | we cloned and sequenced two vitellogenin (vg) cdnas of the carp, cyprinus carpio, using a cdna library constructed from estradiol-17 beta (e2)-treated livers. one was a novel, longer 5000 bp-long cdna termed vg-b2 encoding 1624 amino acids in a single open reading frame. the other was a shorter cdna (vg-b1), identical to that registered previously as carp vg cdna in the international nucleotide sequence database. the deduced amino acid sequences of these two molecules were well-aligned with know ... | 2007 | 17804271 |
| monitoring viral-induced cell death using electric cell-substrate impedance sensing. | using an electrical measurement known as electric cell-substrate impedance sensing (ecis), we have recorded the dynamics of viral infections in cell culture. with this technique, cells are cultured on small gold electrodes where the measured impedance mirrors changes in attachment and morphology of cultured cells. as the cells attach and spread on the electrode, the measured impedance increases until the electrode is completely covered. viral infection inducing cytopathic effect results in drama ... | 2007 | 17826975 |
| dysfunction of dysferlin-deficient hearts. | mutations in the gene encoding dysferlin cause limb-girdle muscular dystrophy 2b (lgmd2b), a disorder that is believed to spare the heart. we observed dilated cardiomyopathy in two out of seven lgmd2b patients and cardiac abnormalities in three others. cardiac biopsies showed that dysferlin was completely absent from the sarcolemma and appeared to be trapped within the cardiomyocytes. sjl/j mice (33-week-old) had diminished end-systolic pressure and reduced dp/dt; however, the hearts were histol ... | 2007 | 17828519 |
| genetic improvement of wild fish populations. | a plan for the genetic improvement of commercially exploited wild animals is presented. it consists of crossing wild with domesticated breeds to produce heterotic hybrids and to upgrade the wild stocks. empirical evidence is presented from experiments with the carp. procedures for monitoring the manipulated populations are outlined. the suggested plan is ecologically reasonable and would counteract the negative genetic changes caused by excessive commercial exploitation of many species. | 1978 | 17830305 |
| transgenic carp: pond-ready? | 1990 | 17843790 | |
| the development of probiotics for the control of multiple bacterial diseases of rainbow trout, oncorhynchus mykiss (walbaum). | jb-1 and gc2, which were equated with bacillus sp. and aeromonas sobria respectively, were recovered from the digestive tract of rainbow trout, oncorhynchus mykiss and ghost carp, cyprinus sp. respectively, and demonstrated effectiveness as probiotics for the control of infections caused by aeromonas salmonicida, lactococcus garvieae, streptococcus iniae, vibrio anguillarum, vibrio ordalii and yersinia ruckeri. when administered to rainbow trout (average weight = 12 g) for 14 days in feed dosed ... | 2007 | 17850573 |
| some quality aspects of fish patties prepared from an indian major carp, labeo rohita (ham.). | six different types of fish patties were prepared from de-boned meat of three weight groups (250 500 g, 501-750 g, and 751-1,000 g) of an indian major carp, labeo rohita, using two extenders (boiled potato and corn flour). the weight of the fish and the type of the extender affected the nutritional quality of the patties. cooking lowered the crude protein but increased the total lipid, total soluble sugars, and contents of the patties. cooking yield increased with an increase in the weight of th ... | 2008 | 17852491 |
| effects of different surfactants on motility and dna integrity of brown trout (salmo trutta fario) and common carp (cyprinus carpio) spermatozoa. | in this study we evaluated effects of surfactants on motility parameters and dna integrity of spermatozoa of freshwater teleost fish. common carp (cyprinus carpio) and brown trout (salmo trutta fario) spermatozoa were exposed to either sodium dodecyl sulphate (sds, anionic surfactant) or octoxynol 9 ( triton x-100, nonionic surfactant). both surfactants added at activation caused a decrease in sperm motility characteristics measured by computer-assisted sperm analysis (casa). intraspecific diffe ... | 2007 | 17873964 |
| evaluation of water productivity and fish yield in sewage-fed vis-à-vis fertilized based carp culture. | reuse of wastewater in aquaculture provides a scope to enhance water productivity of the system. quantification of nutrient inputs incorporated through treated domestic sewage with varying dosages viz. 79.3 x 10(5)lha(-1) and 67.7 x 10(5)lha(-1) and water productivity in a controlled carp culture system were assessed in comparison to those involved in a fertilized based one, with a view to correlate among physical, chemical and biological processes involved in fish yield under the systems. the n ... | 2008 | 17881225 |
| [determination of polybrominated diphenyl ethers (pbdes) in biota using gc/ms method]. | the aim of this study is to build a method of determining pbdes in biota, and to gain the optimum condition of preparation of samples, and the best condition of gas chromatography (gc) and mass spectrometer (ms). also, the requirements of quality, quantity and experimental condition were assessed. according to the validation of the quality control (qc), the results proved that the analytical method satisfied the requirements of the determination of pbdes in biota. the recoveries were between 50. ... | 2007 | 17891975 |
| field and laboratory investigations of the thermal influence on tissue-specific hsp70 levels in common carp (cyprinus carpio). | thermal discharge from power stations can affect normal environmental conditions and change in heat shock proteins expression of native fish with increasing temperature. in this study, we investigated levels of hsp70 in the heart, kidney, brain and gill of the common carp cyprinus carpio both in long-term heat discharge environment and after 24 h acute heat shock exposure. in laboratory exposure experiments, fish acclimated at 10 degrees c were exposed to various elevated temperatures (20, 24 an ... | 2007 | 17900953 |
| the formation of improved tetraploid population of red crucian carp x common carp hybrids by androgenesis. | bisexual fertile diploid androgenetic individuals (a(0)) (2n=100) were formed by androgenesis. in this way, the diploid spermatozoa from male allotetraploid hybrids (at) (4n=200) of red crucian carp (carassius auratus red var.) (female) x common carp (cyprinus carpio l.) (male) were used to fertilize the uv-treated haploid eggs of goldfish (carassius auratus), and living androgenetic diploid fish were developed. the a(0) became sexually mature at the age of 2 years, and they fertilized with each ... | 2007 | 17901933 |
| clinical factors associated with long-term mortality following vascular surgery: outcomes from the coronary artery revascularization prophylaxis (carp) trial. | preoperative cardiac risks and clinical indications for vascular surgery are both important determinants of outcome following a vascular operation. using the nonrandomized cohort from the coronary artery revascularization prophylaxis (carp) trial, we analyzed the predictors of outcome based on the presenting vascular problem and prevalence of comorbid conditions and cardiac risks. | 2007 | 17903649 |
| approach for extrapolating in vitro metabolism data to refine bioconcentration factor estimates. | national and international chemical management programs are assessing thousands of chemicals for their persistence, bioaccumulative and environmental toxic properties; however, data for evaluating the bioaccumulation potential for fish are limited. computer based models that account for the uptake and elimination processes that contribute to bioaccumulation may help to meet the need for reliable estimates. one critical elimination process of chemicals is metabolic transformation. it has been sug ... | 2008 | 17904615 |
| [mapping and genetic effect analysis of quantitative trait loci related to body size in common carp (cyprinus carpio l.)]. | the common carp recombinant inbred lines (ril) derived from the cross barbless carp x hebao-cold tolerance red carp were used as experimental materials in this study. based on the linkage map constructed with simple sequence repeat (ssr) markers using this ril population, marker regression and complexity interval mapping were analyzed by windows map manager2.0 software. a p-value of 0.01 was the threshold value of single-marker. a linkage group-wide permutation test (1 000 replicates) determined ... | 2007 | 17905715 |
| effect of arsenic and chromium on the serum amino-transferases activity in indian major carp, labeo rohita. | arsenic and hexavalent chromium toxicity results from their ability to interact with sulfahydryl groups of proteins and enzymes, and to substitute phosphorus in a variety of biochemical reactions. alanine aminotransferase (alt; e.c: 2.6.1.2) and aspartate amino transferase (ast; ec 2.6.1.1) play a crucial role in transamination reactions and can be used as potential biomarkers to indicate hepatotoxicity and cellular damage. while histopathological studies in liver tissue require more time and ex ... | 2007 | 17911661 |
| gene expression analysis of estrogenic compounds in the liver of common carp (cyprinus carpio) using a custom cdna microarray. | exposure to a variety of compounds with estrogenic activity has been shown to interfere with normal developmental and reproductive processes in various vertebrate species. the aim of this study was to determine the transcriptional profile of the natural estrogen, 17 beta-estradiol, and three synthetic estrogenic compounds (4-nonylphenol, bisphenol a, ethinylestradiol) in the liver of common carp, using a custom cdna microarray. for that purpose, fish were aqueously exposed to three concentration ... | 2007 | 17912697 |
| [carpal dislocation combined with a lunate fracture. report of a case ]. | a fracture of the semi-lunar in the frontal plan seems to be a rare and still exceptional hurt when it accompanies a retro-lunar dislocation of carp. our case allows to see again the lesionnel mechanism of the dislocations of carp particularly in its retro-lunar variety and so to classify our case or rather to individualize it and to put it there "except series". | 2016 | 17913557 |
| helminth infections in common carp, cyprinus carpio l., 1758 (cyprinidae) from kovada lake (turkey). | the aim of this study which was carried out from march 2003-february 2004 was to determine the parasites of carp (cyprinus carpio l., 1758) inhabiting the kovada lake. during the study, a total of 63 common carps were caught in different regions of kovada lake each month and investigated parasitologically. in carps, the ectoparasite, dactylogyrus minutus of monogenea, was found and endoparasites; bothriocephalus acheilognathi and caryophyllaeus laticeps of cestoda were found. the most common par ... | 2007 | 17918067 |
| molecular identification of two strains of third-stage larvae of contracaecum rudolphii sensu lato (nematoda: anisakidae) from fish in poland. | contracaecum sp. larvae (l3) from fish were identified using nucleotide sequences of the internal transcribed spacers its-1 and its-2 of the ribosomal dna. the nematode larvae originated from fish in a freshwater situation (crucian carp carassius carassius, from selment wielki lake in mazury, northeastern poland) and a brackish-water region (caspian round goby neogobius melanostomus from the baltic sea, gdafisk bay at the polish coast). two strains (contracaecum rudolphii a and b) of contracaecu ... | 2007 | 17918390 |
| rutr is the uracil/thymine-sensing master regulator of a set of genes for synthesis and degradation of pyrimidines. | using the genomic selex, a total of six escherichia coli dna fragments have been identified, which formed complexes with transcription factor rutr. the rutr regulon was found to include a large number of genes encoding components for not only degradation of pyrimidines but also transport of glutamate, synthesis of glutamine, synthesis of pyrimidine nucleotides and arginine, and degradation of purines. dnase i footprinting indicated that rutr recognizes a palindromic sequence of ttgaccanntggtcaa. ... | 2007 | 17919280 |
| titin expression in human articular cartilage and cultured chondrocytes: a novel component in articular cartilage biomechanical sensing? | in striated muscle tissues, the giant protein titin acts as a biomechanically active filament system, coupling stress/strain to gene expression. the objective of the study is to show the existence of titin fragments in human articular cartilage, as in diarthodial joints, chondrocytes are also known to sense and respond to stretching. we have surveyed human cultured cartilage collected from adults with osteoarthritis (oa), without oa and from infants with a set of titin antibodies and primer pair ... | 2008 | 17920806 |
| transcription factor sp3 knockout mice display serious cardiac malformations. | mice lacking the zinc finger transcription factor specificity protein 3 (sp3) die prenatally in the c57bl/6 background. to elucidate the cause of mortality we analyzed the potential role of sp3 in embryonic heart development. sp3 null hearts display defective looping at embryonic day 10.5 (e10.5), and at e14.5 the sp3 null mutants have developed a range of severe cardiac malformations. in an attempt to position sp3 in the cardiac developmental hierarchy, we analyzed the expression patterns of >1 ... | 2007 | 17923686 |
| metabolic rate and reactive oxygen species production in different genotypes of gh-transgenic zebrafish. | growth hormone overexpression increases growth and consequently increases the metabolic rate in fishes. therefore, the objective of this study was to evaluate the effects of growth hormone overexpression in zebrafish danio rerio in terms of growth, oxygen consumption, reactive oxygen species production, lipid hydroperoxide content, antioxidant enzyme activity and glutamate-cysteine ligase catalytic subunit gene expression. the employed models were wild type and transgenic (hemizygous and homozyg ... | 2008 | 17931920 |
| depolarization of isolated horizontal cells of fish acidifies their immediate surrounding by activating v-atpase. | in order to interpret the formation of receptive field surrounds in retinal neurons, a proton-mediated mechanism was proposed to mediate feedback from horizontal cells (hcs) to cone photoreceptors. to verify the idea that depolarized hcs release protons, we measured, by a fluorescence ratiometric technique, the ph of the immediate external surface (phs) of hcs isolated from the carp or goldfish retina. when hcs stained by 5-hexadecanoylaminofluorescein, a ph-sensitive lipophilicdye, were depolar ... | 2007 | 17932147 |
| cell cycle and apoptosis regulatory protein-1: a novel regulator of apoptosis in the colonic mucosa during aging. | although the regulatory mechanisms for the age-related rise in proliferation and reduction in apoptosis in the colonic mucosa are yet to be fully delineated, we have demonstrated that these events are associated with increased expression and activation of epithelial growth factor receptor (egfr)/erbb-1 and some of its receptor family members (egfrs), indicating their involvement in these processes. however, the downstream signaling events of egfr and/or its family members regulating age-related ... | 2007 | 17932228 |
| biochemical and histochemical effects of perorally applied endotoxin on intestinal mucin glycoproteins of the common carp cyprinus carpio. | mucins are high molecular weight glycoproteins produced by goblet cells and secreted on mucosal surfaces. we investigated biochemical and histochemical properties of intestinal mucins of virus- and parasite-free common carp cyprinus carpio in response to a single peroral application of endotoxin (lipopolysaccharide = lps). intracellular mucins were quantified histochemically by their carbohydrate content and characterized by specific, lectin-based methods. in addition, secreted epithelial (intra ... | 2007 | 17933394 |
| protein hydrolysate from visceral waste proteins of catla (catla catla): optimization of hydrolysis conditions for a commercial neutral protease. | protein hydrolysate was prepared from visceral waste proteins of an indian freshwater major carp, catla catla. hydrolysis conditions (viz., time, temperature and enzyme to substrate level) for preparing protein hydrolysates from the fish visceral waste proteins using in situ ph of the visceral mass were optimized by response surface methodology (rsm) by employing a factorial design. the regression coefficient close to 1.0, observed during both experimental and validation runs, indicated the vali ... | 2008 | 17933524 |
| isolation and selection of bacillus spp. as potential biological agents for enhancement of water quality in culture of ornamental fish. | to isolate, select and evaluate bacillus spp. as potential biological agents for enhancement of water quality in culture of ornamental fish. | 2007 | 17953558 |
| first detection and confirmation of spring viraemia of carp virus in common carp, cyprinus carpio l., from hamilton harbour, lake ontario, canada. | in june 2006, 150 wild common carp were sampled from hamilton harbour, lake ontario, canada. tissue pools consisting of kidney, spleen and encephalon were screened for viruses as a condition facilitating the export of live carp to france. cytopathic effect (cpe), indicative of a viral infection, became evident after 8 days of incubation at 15 degrees c. eighteen of 30 tissue pools (five fish per pool) eventually demonstrated viral cpe. the viral pathogen was initially cultured and isolated on th ... | 2007 | 17958610 |
| seasonal variations in olfactory sensory neurons--fish sensitivity to sex pheromones explained? | olfactory sensory neurons of vertebrates regenerate throughout the life of the animal. in fishes, crypt cells are a type of olfactory sensory neurons thought to respond to sex pheromones. here, we demonstrate that the number of crypt cells in the olfactory epithelium of the crucian carp varies dramatically throughout the year. during winter, few crypt cells are observed at any location within the sensory epithelium. in spring, the majority of crypt cells are located deep in the epithelium not ye ... | 2008 | 17962228 |
| cloning and study of adult-tissue-specific expression of sox9 in cyprinus carpio. | the sox9 gene is one of the important transcription factors in the development of many tissues and organs, particularly in sex determination and chondrogenesis. we amplified the genomic dna of cyprinus carpio using degenerate primers, and found that there were two versions of sox9 in this species: sox9a and sox9b, that differ in having an intron of different length (704 bp and 616 bp, respectively) in the conserved hmg box region that codes for identical amino acid sequences. we used a two-phase ... | 2007 | 17968136 |
| predator-induced morphology enhances escape locomotion in crucian carp. | fishes show a remarkable diversity of shapes which have been associated with their swimming abilities and anti-predator adaptations. the crucian carp (carassius carassius) provides an extreme example of phenotypic plasticity in body shape which makes it a unique model organism for evaluating the relationship between body form and function in fishes. in crucian carp, a deep body is induced by the presence of pike (esox lucius), and this results in lower vulnerability to gape-limited predators, su ... | 2008 | 17971327 |
| establishment, characterization, and viral susceptibility of two cell lines derived from goldfish carassius auratus muscle and swim bladder. | goldfish carassius auratus are common aquarium fish and have a significant economic and research value, having considerable worth to fisheries as a baitfish and the ability to adapt to a range of habitats. two cell lines were established from goldfish muscle and swim bladder tissue, in order to create a biological monitoring tool for viral diseases. cell lines were optimally maintained at 30 degrees c in leibovitz-15 medium supplemented with 20% fetal bovine serum. propagation of goldfish cells ... | 2007 | 17972754 |
| molecular cloning and characterization of carp (cyprinus carpio l.) cd8beta and cd4-like genes. | partial cdna sequences of both cd8beta and cd4-like (cd4l) genes of common carp (cyprinus carpio l.) were isolated from thymus cdna library by the method of suppression subtractive hybridization (ssh). subsequently the full length cdnas of carp cd8beta and cd4l were obtained by means of 3' race and 5' race, respectively. the full length cdna of carp cd8beta is 1164 bp and encodes 207 amino acids including a signal peptide region of 24 amino acids, a transmembrane region of 23 amino acids from aa ... | 2007 | 17977746 |
| comparative thyroidology: thyroid gland location and iodothyronine dynamics in mozambique tilapia (oreochromis mossambicus peters) and common carp (cyprinus carpio l.). | in teleosts, the thyroid gland is mostly found in the subpharyngeal region. however, in several species thyroid follicles are found in, for example, heart, head kidney and kidney. such heterotopic thyroid follicles are active, and considered to work in concert with the subpharyngeal thyroid. in mozambique tilapia (oreochromis mossambicus) thyroid activity is, indeed, restricted to the subpharyngeal region; in common carp (cyprinus carpio) the functional endocrine thyroid is associated with renal ... | 2007 | 17981868 |
| species of environmental mycobacteria differ in their abilities to grow in human, mouse, and carp macrophages and with regard to the presence of mycobacterial virulence genes, as observed by dna microarray hybridization. | there are many species of environmental mycobacteria (em) that infect animals that are important to the economy and research and that also have zoonotic potential. the genomes of very few of these bacterial species have been sequenced, and little is known about the molecular mechanisms by which most of these opportunistic pathogens cause disease. in this study, 18 isolates of em isolated from fish and humans (including strains of mycobacterium avium, mycobacterium peregrinum, mycobacterium chelo ... | 2008 | 17981953 |
| carps are e3 ligases that target apical caspases and p53. | apoptosis is mediated by executioner caspases that are negatively regulated by the inhibitors of apoptosis (iaps). apical or initiator caspases are not the substrates of iaps for degradation or sequestration. newly characterized proteins, caspases-8/10 associated ring proteins 1 and 2 (carp1/2) exhibit significant similarity to classical inhibitors of apoptosis (iaps) in both structure and function, however the diverse substrate specificity of carps distinguishes them from the family of iaps. ca ... | 2007 | 17986872 |