Publications
| Title | Abstract | Year Filter | PMID(sorted ascending) Filter |
|---|
| gas-producing necrotizing fasciitis following mandibular fracture. | a case of necrotizing fasciitis following a mandibular fracture is reported. the diagnosis and treatment of the disease are discussed. | 1989 | 2545847 |
| phospholipase c and haemolytic activities of clostridium perfringens alpha-toxin cloned in escherichia coli: sequence and homology with a bacillus cereus phospholipase c. | the clostridium perfringens alpha-toxin (phospholipase c) gene (cpa) has been cloned and expressed in escherichia coli. the biological activities of the cloned gene product have been analysed and the complete nucleotide sequence of the cpa gene has been determined. the cloned cpa gene product, which is exported to the periplasm in e. coli, possesses both phospholipase c and haemolytic activities. haemolysis is not apparent when cell extracts are incubated with isotonic suspensions of sheep eryth ... | 1989 | 2546005 |
| postpartum uterine infection with clostridium perfringens. | clostridium perfringens is commonly present in the female genital tract. uterine infection with this organism is a potentially fatal disease infrequently seen in obstetric practice. the manifestations of c. perfringens uterine infection are variable, ranging from endometritis to gas gangrene with fulminant septicemia. the usual precipitating event has been septic abortion, but such infections can also occur spontaneously in uterine tumors and after complicated deliveries requiring mechanical int ... | 1989 | 2546243 |
| bacteria and gallstone nucleation. | this preliminary study reports for the first time that there might be a possible association between bacteria and the aetiology of some cholesterol calculi. the gall-bladder biles from 225 cholecystectomy patients underwent bacteriological and microscopic study. cholesterol calculi from 13 patients (10.2%) were observed to be associated with gall-bladder bile profusely infected with at least one bacterial species that was shown to possess beta-glucuronidase activity, an enzyme that is thought to ... | 1989 | 2546527 |
| avoiding injuries caused by pigs. | 1989 | 2546640 | |
| bacterial overgrowth in the jejunum of icr mice and wistar rats orally administered with a single lethal dose of fusarenon-x, a trichothecene mycotoxin. | a single oral dose of fusarenon-x (f-x), a trichothecene mycotoxin, resulted in abnormal microflora in the jejunum in icr mice and wistar rats with some differences in dose response between the species. in the acute phase, enterobacteria, streptococci, clostridium perfringens and bacteroides showed remarkably increased counts in the jejunum of mice and rats dosed with f-x while lactobacilli showed a decrease in count. f-x brought an invasion of pseudomonas aeruginosa into the livers, lungs, kidn ... | 1989 | 2546912 |
| porcine clostridium perfringens type a spores, enterotoxin and antibody to enterotoxin. | forty-two clostridium perfringens type a strains isolated from cases of diarrhoea in pigs were tested for their ability to sporulate and produce enterotoxin in three different sporulation media. enterotoxin was produced by 11 of the 42 c perfringens type a isolates (26.2 per cent). thirteen isolates (30.9 per cent) produced spores at a frequency of 10 per cent or more. spore production was recorded in 24 (57.1 per cent) of the isolates. the titres of enterotoxin produced by the isolates ranged f ... | 1989 | 2547268 |
| comparison of fecal microflora of elderly persons in rural and urban areas of japan. | the fecal microflora of 15 healthy elderly persons with a median age of 84 years in a rural area whose inhabitants tend to be long-lived (yuzurihara-area, uenohara, yamanashi prefecture) was compared with the microflora of individuals with a median age of 68 years in an urban area (tokyo). the diet of the elderly persons in the yuzurihara area is characterized by a high intake of dietary fiber. total numbers of anaerobic bacteria were significantly smaller in the elderly persons in the yuzurihar ... | 1989 | 2547333 |
| alteration of the spermatozoal glycocalyx and its effect on duration of fertility in the fowl (gallus domesticus). | the hypothesis that sialic acid has a role in spermatozoal sequestration within the hen's oviduct was tested by treating spermatozoa with clostridium perfringens neuraminidase. spermatozoal content of sialic acid ranged from 94 to 135 micrograms per 10(9) spermatozoa (n = 12 roosters). spermatozoa contained 80% of total seminal sialic acid (coefficient of variation = 4.6%). spermatozoal sialic acid content was reduced by 18% when 10(9) spermatozoa were incubated at ph 6.5 with 10 iu neuraminidas ... | 1989 | 2547463 |
| anaerobic infections. | 1989 | 2547928 | |
| [the occurrence of escherichia coli, aeromonas hydrophila, plesiomonas shigelloides and clostridium perfringens in the intestinal flora of gray herons (ardea cinerea)]. | the flora of the large intestine of 92 grey herons was examined for the frequency of aerobic and microaerobic growing bacteria. clostridium perfringens, aeromonas hydrophila, plesiomonas shigelloides and e. coli were isolated from 55%, 48%, 14% and 35% of the birds, respectively. it could be demonstrated that the findings of these bacteria in the intestinal flora are depending on the age of the birds. the percentage of carriers of clostridium perfringens, aeromonas hydrophila and plesiomonas shi ... | 1989 | 2548355 |
| comparative antibacterial activity of the new cephalosporin cefcanel against anaerobic bacteria. | the activity of cefcanel against anaerobic cocci, clostridium perfringens, bacteroides fragilis, bacteroides spp. and fusobacteria was determined by the agar dilution method and compared with the activity of cefaclor, cephalexin, cefadroxil, phenoxymethylpenicillin and ampicillin. cefcanel showed good activity against clostridium perfringens, bacteroides spp. and fusobacteria (mic90 = 1-4 mg/l). against anaerobic cocci its mic90 value was 16 mg/l, and against bacteroides fragilis, 32 mg/l. cefca ... | 1989 | 2548866 |
| modulation of clostridium perfringens intestinal colonization in infants delivered by caesarean section. | the colonization by clostridium perfringens was investigated in 19 infants delivered by caesarean section during the two first weeks of life. the pattern of c. perfringens colonization depended upon the feeding. breast feeding led to the repression of c. perfringens, whereas bottle feeding allowed its maintenance. on the contrary, bifidobacterium bifidum growth was favoured by breast feeding. however, in one breast-fed infant, b. bifidum was never isolated and c. perfringens decreased. breast fe ... | 1989 | 2548965 |
| nosocomial diarrhea associated with enterotoxigenic clostridium perfringens infection in dogs. | a retrospective analysis of the medical records of 30 consecutive cases of diarrhea occurring in dogs that were hospitalized in a teaching hospital was performed. a prospective analysis of culture results for clostridium perfringens of dogs with diarrhea were compared with those of a control nondiarrheal group. hospital-acquired diarrhea in dogs was found to be associated with multiple serotypes of enterotoxigenic clostridium perfringens. other potential etiologic agents could not be isolated. c ... | 1989 | 2548985 |
| [dna helix-coil transition in alkaline medium]. | dna helix-coil transition in th alkaline medium was considered theoretically and experimentally. on the basis of the theory and experimental comparison the dna double-stranded form deprotonation was revealed. | 1989 | 2549396 |
| genome organization of the anaerobic pathogen clostridium perfringens. | a physical map of the genome of clostridium perfringens, an important human pathogen, has been established by pulsed-field gel electrophoresis. recognition sites for six rare-cutting endonucleases were situated on a single circular chromosome of approximately 3.6 million base pairs thus defining 50 arbitrary genetic intervals of between 10 and 250 kilobase pairs. this considerably facilitated the chromosomal localization of some 24 genes and loci for which probes were available and allowed the c ... | 1989 | 2549543 |
| infectious anemia caused by a parvovirus-like virus in georgia broilers. | pale chicks with necrotic dermatitis, small bursas of fabricius (bfs), small thymuses, pale bone marrow, and watery blood were suspected of having parvovirus-like virus- (pvlv) associated disease. histologic lesions included atrophy or hypoplasia of thymuses and bfs, and septic necrotizing clostridial dermatitis and hepatitis. clostridium perfringens was cultured from skin and liver. a pvlv was isolated in a marek's disease tumor cell line (mdcc-msb1) culture and was identified by physicochemica ... | 1989 | 2549935 |
| evidence that alterations in small molecule permeability are involved in the clostridium perfringens type a enterotoxin-induced inhibition of macromolecular synthesis in vero cells. | the mechanism by which clostridium perfringens enterotoxin (cpe) simultaneously inhibits rna, dna, and protein synthesis is unknown. in the current study the possible involvement of small molecule permeability alterations in cpe-induced inhibition of macromolecular synthesis was examined. vero cells cpe-treated in minimal essential medium (mem) completely ceased net precursor incorporation into rna and protein within 15 minutes of cpe treatment. however, rna and protein synthesis continued for a ... | 1989 | 2550473 |
| fatal clostridial pancreatitis following ercp and percutaneous needle biopsy. | a patient with a large necrotic pancreatic carcinoma underwent ercp and percutaneous biopsy of the cancer and of a suspected hepatic metastasis. on the second day, she developed a massive hemolysis with a 50% drop of hemoglobin level and a rise of serum bilirubin level from 1.3 to 37.5 mg%. gas was noted on followup ct scan of the pancreas. clostridium perfringens was found by needle aspiration of the pancreas and on multiple blood cultures. death resulted from sepsis on the fourth day. since er ... | 1989 | 2550563 |
| [an outbreak of enterocolitis due to clostridium perfringens in a hospital for the severely disabled]. | we had an outbreak of 14 cases of enterocolitis due to clostridium perfringens (cl. perfringens) in a hospital for the severe multiply-disabled, where the 100 disabled were admitted, in summer in 1985. the signs and symptoms shown by this enterocolitis were primarily diarrhea without fever and loss of appetite. the feces of 10 cases were examined bacteriologically. the test showed 10(3) to 10(6) cells of cl. perfringens per one gram of their feces and all the strains isolated were untypable by t ... | 1989 | 2550564 |
| phospholipase c-mediated intestinal mucosal damage is ameliorated by quinacrine. | phospholipase c from clostridium perfringens, when injected into a closed loop of the rat small intestine in vivo, caused an increase in the activity of intraluminal n-acetyl-beta-glucosaminidase and mucosal permeability to sodium fluorescein, indicating damage to the mucosa. phospholipase c also caused an influx of granulocytes (neutrophils) into the mucosa, as shown by the myeloperoxidase activity--a granulocyte neutrophil marker, and increased localized lipid peroxidation. pretreatment of ani ... | 1989 | 2551803 |
| [analyses of pathogenic factors in bacteria--bacterial toxins: clostridial toxins, e.g. c. tetani neurotoxins and c. perfringens type a enterotoxin]. | 1989 | 2552188 | |
| cloning and hybridization analysis of ermp, a macrolide-lincosamide-streptogramin b resistance determinant from clostridium perfringens. | the erythromycin resistance determinant from clostridium perfringens cp592 was cloned and shown to be expressed in escherichia coli. the resultant plasmid, pjir122 (7.9 kilobase pairs [kb]), was unstable since in both reca+ and reca e. coli hosts spontaneous deletion of 2.7 kb, including the erythromycin resistance determinant, was observed. subcloning, as well as deletion analysis with bal 31, localized the erythromycin resistance gene (ermp) to within a 1.0-kb region of pjir122. a 0.5-kb fragm ... | 1989 | 2552908 |
| vero cell assay for rapid detection of clostridium perfringens enterotoxin. | a rapid assay which measured the biological activity of clostridium perfringens enterotoxin was developed. the method involved the rapid killing of vero cells by enterotoxin produced by c. perfringens grown in duncan and strong sporulation medium. serial dilutions of toxin were added to vero cells either in suspension or grown as monolayers in wells of a 96-well cell tissue culture cluster plate. vital staining of vero cells with neutral red, followed by extraction of the dye, allowed toxin leve ... | 1989 | 2552918 |
| [the seasonal toxigenicity of different cultured plants for clostridia in relation to so-called wildlife mortality]. | in the juice of plants which could be eaten by hares different amounts of toxins (haemolysin, lecithinase) could be found after the partly addition of a c. perfringens field strain and subsequent anaerobic incubation. sterile filtrates showed a very pronounced toxigenicity. the presented results proof in tendency that oilseed-rape (00-rape seed), wheat, and barley as green plants can contribute in clostridial toxicosis in hares, whereas grass and beets are involved only partially, and clover is ... | 1989 | 2552986 |
| effect of n,n'-bis(alkyldimethyl)-alpha, omega-alkanediammonium dibromides on bacteria of the genus clostridium. | antibacterial effect of 17 ammonium compounds of the type of n,n'-bis(alkyldimethyl)-alpha, omega-alkanediammonium dibromides was tested on anaerobically sporulating bacteria of the genus clostridium. a sizable antibacterial activity was displayed by five n,n'-bis(alkyldimethyl)-1,6-hexanediammonium dibromides and by four n,n'-bis(decyldimethyl)-alpha, omega-alkanediammonium dibromides. these compounds exhibited activity higher than, or comparable with, that of the reference standards ajatin and ... | 1989 | 2553558 |
| susceptibility of anaerobic bacteria to meropenem. | the activity of meropenem was determined against 350 strains of anaerobic bacteria by an agar dilution method. it was compared with those of piperacillin, cefoxitin, imipenem, clindamycin, metronidazole and chloramphenicol. meropenem and imipenem were the most active agents tested. on the basis of these results, meropenem appears to be a promising antimicrobial agent for anaerobic infections and warrants further clinical investigation. | 1989 | 2553656 |
| rubredoxin from clostridium perfringens: complete amino acid sequence and participation in nitrate reduction. | the complete primary structure of rubredoxin (rd) isolated from clostridium perfringens was sequenced to be: mkkficdvcgyiydpavgdpdngvepgtefkdipddwvcplcgvdksqfsetee. the sequence was highly homologous to that of c. pasteurianum rd but was different at 13 sites out of the total 54 amino acid residues (76% homology). it contained 1 fe atom, 4 cysteine residues, and no labile sulfur, had a molecular weight of 6,056, and shared the general properties of classical anaerobic rds. the pi was 4.4. the rd ... | 1989 | 2553684 |
| interaction of clostridium perfringens delta toxin with erythrocyte and liposome membranes and relation with the specific binding to the ganglioside gm2. | the specific interaction of the cytolytic clostridium perfringens delta toxin with membrane gm2 was indicated by: (i) characterization of this glycolipid in the membrane of sheep and goat erythrocytes, which are lysed by the toxin, whereas gm2 was undetectable in insensitive rabbit erythrocytes, (ii) demonstration of 125i-toxin binding to gm2, by autoradiography, following incubation with thin-layer chromatograms containing separated neuroblastoma gangliosides, and (iii) toxin fixation by phosph ... | 1989 | 2554536 |
| hybridization analysis of three chloramphenicol resistance determinants from clostridium perfringens and clostridium difficile. | the chloramphenicol resistance determinant from a nonconjugative strain of clostridium perfringens was cloned and shown to be expressed in escherichia coli. subcloning and deletion analysis localized the resistance gene, catq, to within a 1.25-kilobase (kb) partial sau3a fragment. the catq gene contained internal hindii, haeiii, and drai restriction sites and was distinct from the catp gene, which was originally cloned (l. j. abraham, a. j. wales, and j. i. rood plasmid 14:37-46, 1985) from the ... | 1989 | 2554801 |
| [purification of phospholipase c isoenzyme 1 from clostridium perfringens and its properties]. | a procedure for the purification of isoenzyme i of phospholipase c from cl. perfringens was developed. the isoenzyme was purified to homogeneity (data from disc electrophoresis) using affinity chromatography on polycephamide and gel filtration through ultrogel aca-54, the enzyme yield being 41%. some properties of the purified isoenzyme i (ph and temperature optima, stability, effect of metal ions and detergents, substrate dependence) were investigated. no significant differences between the pro ... | 1989 | 2554985 |
| concentration of giardia lamblia cysts, legionella pneumophila, clostridium perfringens, human enteric viruses, and coliphages from large volumes of drinking water, using a single filtration. | poliovirus, coliphages, giardia lamblia cysts, clostridium perfringens spores, and legionella pneumophila were concentrated simultaneously in a single pass by sequential filtration of large volumes of drinking water through 3- and 1-micron wound electronegative fiberglass cartridge filters (25.4 cm). filtration was performed under acidic conditions (ph 3.5) in the presence of 0.001 m aluminum chloride to enhance adsorption. elution of all the microorganisms entrapped or adsorbed to the filters w ... | 1989 | 2555036 |
| electroporation-mediated transformation of lysostaphin-treated clostridium perfringens. | a reliable and efficient method has been developed for the electroporation-mediated transformation of clostridium perfringens with plasmid dna. transformation of vegetative cells of c. perfringens strain 13 with the 7.9-kb escherichia coli-c. perfringens shuttle plasmid phr 106 required pretreatment with lysostaphin (2 to 20 micrograms/ml) for 1 h at 37 degrees c. cells harvested early in the logarithmic stage of growth were transformed more efficiently than cells at other growth phases. the tra ... | 1989 | 2555265 |
| [the possibility of the germination of spores of pathogenic clostridia and bacilli in soil]. | a possibility of germination of clostridia (cl. tetani and cl. perfringens) and bacilli (bac. anthracis, sti vaccine strain) has been studied in model experiments with native soil. mature spores did not germinate upon contact with native soil of deferent agrochemical types. addition of meat-pepton medium and other protein, amino acid, and sugar-containing media led only to "swelling" of spores. the data obtained support the conclusions drawn by many researches that pathogenic clostridia and baci ... | 1989 | 2555404 |
| [fulminant gas gangrene panophthalmia following perforating scleral injury]. | a 13-year-old boy developed clostridium perfringens panophthalmitis due to a penetrating scleral injury. the characteristic symptoms were unusually severe periocular pain, lid edema, decreased motility and protrusion of the eye, severe conjunctival chemosis, pus covering the conjunctiva and cornea, green-brown hypopyon, gas bubbles in the anterior chamber, and amaurosis within 60 hours. in view of the patient's ocular status and impaired general condition enucleation was unavoidable. the results ... | 1989 | 2555626 |
| clostridium perfringens septicemia with massive hemolysis. | massive hemolysis with acute renal failure occurred in a previously healthy 69-year-old patient as a complication of clostridium perfringens septicemia secondary to gall bladder empyema. to our knowledge, this is one of the few patients with c. perfringens septicemia and massive intravascular hemolysis who survived the episode and regained a normal renal function. | 1989 | 2555910 |
| molecular cloning of the 3' half of the clostridium perfringens enterotoxin gene and demonstration that this region encodes receptor-binding activity. | clostridium perfringens type a enterotoxin (cpe) causes the symptoms associated with c. perfringens food poisoning. to determine whether the c-terminal half of cpe contains receptor-binding activity, the 3' half of the cpe structural gene was cloned with an escherichia coli expression vector system. e. coli lysates containing the expressed c-terminal cpe fragment (cpefrag) were then assayed for cpe-like serologic, receptor-binding, and cytotoxic activities. cpefrag was shown to contain an epitop ... | 1989 | 2556374 |
| recovery of viruses and bacteria in waters off bondi beach: a pilot study. | a pilot study was conducted between february and april, 1989, on the occurrence of sewage-derived viruses and bacteria in the beach and nearshore waters off bondi, sydney. enteroviruses were isolated from 41% of a total of 66 sewage, sea-water, grease and sediment samples. poliovirus vaccine strains accounted for 78% of the isolates. adenoviruses were isolated four times and coxsackievirus b was isolated twice in samples that were collected away from the bathing area. rotavirus and hepatitis a v ... | 1989 | 2556634 |
| purification and characterization of neuraminidase from clostridium perfringens. | neuraminidase (ec 3.2.1.18) has been purified from the culture medium of clostridium perfringens atcc 10543, through steps of gel filtration on sephadex g-75 column, deae-cellulose de 23 anion exchange chromatography, and isochromatofocusing. a homogeneous enzyme was obtained with a 7552-fold increase in specific activity to 295 units/mg protein. the yield was about 25%. the enzyme consists of a single polypeptide with a molecular weight of 69,000 as determined by sds-polyacrylamide gel electrop ... | 1989 | 2556722 |
| cloning in escherichia coli of the enterotoxin gene from clostridium perfringens type a. | a 26 bp dna probe has been constructed with minimal degeneracy to the protein sequence for clostridium perfringens enterotoxin. the probe has been hybridized against a 6-10 kb chromosomal bank from c. perfringens 8239, prepared as a hindiii partial digest in phg165. from this survey a clone has been identified containing a 6.8 kb dna insert with strong hybridization to the probe. direct plasmid sequencing has identified a translational reading frame within this clone which correlates with the kn ... | 1989 | 2557378 |
| polyarticular clostridium perfringens pyoarthritis. | a woman with rheumatoid arthritis presented with an abdominal mass and clostridium perfringens septic arthritis in both wrists and shoulders. we believed this to be the first reported case of polyarticular septic arthritis due to clostridium perfringens. apatite, lipid, and cholesterol crystals in the shoulder joint effusions were a potential source of diagnostic confusion. | 1989 | 2557448 |
| detection of lactobacilli and their interaction with clostridia in human gastrointestinal tracts and in vitro. | culture counts of aerobic lactobacilli in the feces of vegetarians ([8.1 +/- 0.7] of log10 bacteria per gram dry weight) were higher than those of meat consumers ([5.2 +/- 0.1] of log10 bacteria per gram dry weight). co-culture of lactobacillus acidophilus and clostridium perfringens in various media revealed that an interaction between these two species. the ph was the most important factor controlling their relative growth, which might explain the relative abundance of lactobacilli in feces of ... | 1989 | 2558007 |
| comparative study of visual inspections and microbiological sampling in premises manufacturing and selling high-risk foods. | the possible relationship between the results of a microbiological sampling programme and visual inspections carried out in local food-manufacturing premises was examined. using five main parameters - overall appearance, personal hygiene, risk of contamination, temperature control, and training and education - a visual inspection rating score was established for each of the premises. a variety of high-risk processed foods, and specimens from hands, wiping cloths and environmental swabs were exam ... | 1989 | 2558030 |
| the survival patterns of selected faecal bacteria in tropical fresh waters. | the survival of various faecal bacteria used as indicators of the faecal contamination of water supplies has been investigated in a tropical environment (sierra leone). isolates representing the thermotolerant coliform (ttc) and faecal streptococcus (fs) groups, clostridium perfringens and salmonella spp. were studied over a 48 h period of immersion in water from three different sources. survival patterns varied according to source type, but some general observations were made: a portion of the ... | 1989 | 2558031 |
| the site of bluetongue virus attachment to glycophorins from a number of animal erythrocytes. | bluetongue virus (btv) was shown to agglutinate human, ovine and porcine erythrocytes. removal of neuraminic acid (na) from erythrocytes by vibrio cholerae neuraminidase prevented their agglutination. haemagglutination was also inhibited by n-acetyl neuraminic acid (nana), n-glycol neuraminic acid (ngna) and n-acetyl neuramin-lactose. the ability of btv to agglutinate trypsin-treated human erythrocytes, which lack the amino-terminal domain and the single n-linked oligosaccharide of glycophorin a ... | 1989 | 2558161 |
| use of host modified bacteriophages in development of a phage typing scheme for clostridium perfringens. | a bacteriophage isolated from a faecal strain of clostridium perfringens was adapted to a number of host strains of clinical swab and faecal isolates. a typing scheme was developed using nine host modified phages. of 109 strains the phage types of 57 (52.3%) were identified. nine (8.2%) other strains were sensitive to the phages at varying degrees. the remaining 43 (39.4%) strains were resistant. eleven of the 57 typable strains yielded cell-surface mutants which belonged to different phage type ... | 1989 | 2558270 |
| phase-transfer-catalysed synthesis of n-acetylneuraminic acid alpha-thioketosides and inhibitor studies with clostridium perfringens sialidase. | the alpha-thioketosides of methyl 5-acetamido-4,7,8,9-tetra-o-acetylneuraminate with thioacetic acid, thiophenol, 4-nitrothiophenol, 4-aminothiophenol, 2-mercaptopyridin and mercaptobenzothiazol as aglycones were synthesized by phase-transfer catalysis in good yields. the methyl 5-acetamido-4,7,8,9-tetra-o-acetyl-2-thioacetylneuraminate is the analogous thio compound to the methyl 5-acetamido-2,4,7,8,9-penta-o-acetylneuraminate and can be used as intermediate for preparing s-ketosides of neu5ac. ... | 1989 | 2558681 |
| analysis of plasmid profiling as a method for rapid differentiation of food-associated clostridium perfringens strains. | plasmid analysis of over 120 strains of clostridium perfringens, isolated during food-poisoning incidents and from animal carcasses and food constituents with no association with food poisoning, showed the potential of plasmid profiling as a means of differentiating epidemiologically related strains. on average 65% of freshly isolated strains contained one or more plasmids which could be used in the analysis. comparison of profiles of strains from unrelated sources or unrelated strains from the ... | 1989 | 2559071 |
| coat and enterotoxin-related proteins in clostridium perfringens spores. | coat proteins from mature spores of two enterotoxin-positive (ent+) and two enterotoxin-negative (ent-) strains of clostridium perfringens were solubilized using 50 mm-dithiothreitol and 1% sodium dodecyl sulphate at ph 9.7, and alkylated using 110 mm-iodoacetamide to prevent aggregation. the coat proteins and c. perfringens type a enterotoxin (cpe) were separated by sds-page and analysed by western blotting using anti-cpe antibody. as previously reported, cpe aggregated in the presence of sds, ... | 1989 | 2559148 |
| [rapid diagnosis in clostridium perfringens wound infections]. | prompt and early microbiological differential diagnosis is essential for clinical presumptive diagnosis of gas gangrene. the differential diagnosis includes clostridial myositis (gas gangrene), clostridial cellulitis and other gas producing infections. examination of gram preparation (bacterioscopy) and detection of the etiologic agent in muscle specimens are necessary for diagnosis. clostridium perfringens has been shown as the causative organism of gas gangrene. a method is reported which allo ... | 1989 | 2559553 |
| susceptibility of anaerobic bacteria to the new streptogramin rp 59500 in vitro. | the activity of the new streptogramin rp 59500 in vitro was determined against 380 strains of anaerobic bacteria by an agar dilution method and compared with that of pyostacine, piperacillin, cefoxitin, imipenem, clindamycin, metronidazole and chloramphenicol. rp 59500 and imipenem were the most active agents tested. on the basis of these results, rp 59500 appears to be a promising antimicrobial agent for treatment of anaerobic infections, further clinical investigations being warranted. | 1989 | 2559846 |
| preparation of cytidine 5'-monophospho-n-acetylneuraminic acid and uridine 5'-diphosphoglucuronic acid; syntheses of alpha-2, 6-sialyllactosamine, alpha-2, 6-sialyllactose, and hyaluronic acid. | 1989 | 2560122 | |
| endo-beta-galactosidase releasing ga1(alpha 1----3)gal. | 1989 | 2560128 | |
| gene cloning shows the alpha-toxin of clostridium perfringens to contain both sphingomyelinase and lecithinase activities. | the plc gene encoding the alpha-toxin (phospholipase c), an important virulence factor of clostridium perfringens, has been cloned, sequenced and expressed in escherichia coli. transcriptional analysis of mrnas produced in vivo by c. perfringens and e. coli, and in vitro using purified rna polymerase from c. perfringens revealed that plc is transcribed constitutively from a single promoter situated about 100 nucleotides from the coding sequence. a t7 expression system was used to overproduce alp ... | 1989 | 2560137 |
| influence of ph, nutrient availability, and growth rate on amine production by bacteroides fragilis and clostridium perfringens. | dimethylamine, methylamine, propylamine, and pyrrolidine were the major amines formed by bacteroides fragilis ncdo 2217 during the active phase of growth in batch culture. production of these metabolites was strongly ph dependent and was optimal under acidic conditions (ph 6.0). low ph also favored the formation of pyrrolidine, cadaverine, and dimethylamine by clostridium perfringens c523, but the reverse was the case with putrescine, butylamine, and propylamine, where production was maximal at ... | 1989 | 2560361 |
| the effect of passive immunization on active immunity against clostridium perfringens type d in lambs. | lambs in different stages of development of active immunity against clostridium perfringens type d were treated with partially purified immunoglobulin in an attempt to superimpose a passive immunity on an existing or developing active immunity. three different studies were undertaken to determine the impact of partial purified immunoglobulins on these vaccinated animals. in 2 of the 3 studies, active immunity was induced by administering the normal routine enterotoxaemia vaccinations and allowin ... | 1989 | 2560536 |
| polynucleotide cross-linking by aluminum. | the observations that there was an increased concentration of al in the brains of alzheimer's, guam-parkinson, and amyotrophic lateral sclerosis disease patients and that there was an apparent localization of the al in chromatin led to a study of the interaction of al(iii) with dna. we have previously shown that al cross-links calf thymus dna at low ph (s. j. karlik, g. l. eichhorn, p. n. lewis, and d. r. crapper, biochemistry 19, 5991 [1980]). extended studies indicate that cross-linking occurs ... | 1989 | 2560791 |
| the microbiological quality of erzincan (savak) tulum cheese from turkish retail markets. | twenty samples of erzincan (savak) tulum cheese were investigated for the microbiological quality and some chemical analyses. cheese was characterized by moisture content means = 45.0%; 3.27% sodium chloride and 2.14% acidity. significant variation was found in the major compositional factors indicating a general lack of quality and/or extreme diversity of the manufacturing conditions. microbiological test revealed the presence of very high count of total coliforms, psychrotrophic bacteria, yeas ... | 1989 | 2560817 |
| reduction of cyclic amp phosphodiesterase activity of several subcellular fractions of rat brain after pretreatment with phospholipase c. | cyclic amp phosphodiesterase (pde) activity was assayed in the plasma membrane, mitochondrial and microsomal fractions of rat brain. the specific activity of the enzyme was highest in the plasma membrane fraction followed by mitochondrial and then the microsomal fraction. phosphodiesterase activity of all three fractions was reduced after pretreatment with lecithinase c (pcase) from clostridium perfringens but less markedly affected by the pretreatment with sphingomyelinase (smase) from human pl ... | 1989 | 2561441 |
| [polyagglutinability in erythrocytes]. | a case of erythrocyte polyagglutinability is presented which developed in a patient who underwent surgery in the course of infection with clostridium perfringens. when blood transfusion became necessary it was decided that the patient be transfused with concentrated and washed erythrocytes. the transfusion was well tolerated. with the curing of the infection the polyagglutinability also disappeared. | 1989 | 2561490 |
| [the incidence of enterotoxigenic escherichia coli, rotavirus and clostridium perfringens from cases of diarrhea in children, in the region of campinas, sp, brazil]. | a survey for the detection of enterotoxigenic escherichia coli (etec), rotavirus and enterotoxigenic clostridium perfringens in diarrheic stools of children up to 2 years old was carried out in the region of campinas, sp, brazil. twenty-seven (20.45%) faecal specimens were positive for etec. from these samples 41 strains of etec were isolated from which 40 produced only thermolabile (lt) enterotoxin, as detected by a modified radial immune haemolysis test. among the 183 faecal specimens examined ... | 1989 | 2561801 |
| experimental models for studying the microbial ecology in the intestinal tract. | 1989 | 2561802 | |
| [detection of toxins of clostridium perfringens type a in infected animals by using the elisa test]. | the aim of this study was to evaluate the usefulness of elisa in toxin detection in guinea pigs experimentally infected with toxinogenic strain of clostridium perfringens type a. the toxin was detected in blood serum and muscles from 12 hours after infection. the results obtained indicate the advantage of elisa over to date methods used as immunofluorescence or microscopic examination of muscle exudate or sections. elisa due to its high sensitivity rapidity and specificity allows to detect toxin ... | 1989 | 2561810 |
| dot-enzyme linked immunosorbent assay for detection of clostridium perfringens type a enterotoxin. | a procedure, which we have termed dot-elisa, to detect clostridium perfringens type a enterotoxin on nitrocellulose paper is described. seventy eight preparations from 39 cultures of c. perfringens type a were tested simultaneously by this and by plate-elisa methods. the results were comparable. dot-elisa detected as little as 0.02 micrograms of purified enterotoxin and 0.13 micrograms of enterotoxin in cell-free culture supernatant. as little as 0.02 micrograms purified enterotoxin mixed with h ... | 1989 | 2561874 |
| preincubation time and the use of oxygen indicators in determining the microbiological quality of aseptically packed pea and tomato soup. | in order to get accurate information about the preincubation time needed for viscous aseptic products, the growth characteristics of three food poisoning organisms staphylococcus aureus, clostridium perfringens and bacillus cereus in pea soup, and one spoilage organism, lactobacillus plantarum, in tomato soup, were followed during a preincubation period at 30 degrees c for 14 days. the sterile food packs were sealed into polyamidepolyethylene laminate bags containing different headspace gas conc ... | 1989 | 2561900 |
| spoilage of an acid food product by clostridium perfringens, c. barati and c. butyricum. | spoilage of canned pasteurized brined mung bean sprouts, acidified with citric acid to ph 4.0-4.5, was found to be caused by acid tolerant clostridium spp. including the species barati, perfringens and butyricum. the ph limit for growth in the brine used were estimated 3.7, 3.7 and 4.0 respectively. some of the isolated c. perfringens strains produced enterotoxins in sporulation media. the spores of the isolated anaerobes appeared to originate from mung beans, but c. barati and c. perfringens st ... | 1989 | 2561952 |
| antibacterial effect of the glucose oxidase-glucose system on food-poisoning organisms. | the antibacterial effect of the glucose oxidase-glucose system was studied on food-poisoning organisms including staphylococcus aureus, salmonella infantis, clostridium perfringens, bacillus cereus, campylobacter jejuni, listeria monocytogenes and yersinia enterocolitica using automated turbidometry. the bacteria were grown in sterile-filtered meat medium which was either raw or heat-denaturated. the results showed a clear growth inhibition with combinations of 0.5-1.0 mg/ml glucose and 0.5-1.0 ... | 1989 | 2561954 |
| a bacteriologic study of scabby-hip lesions from broiler chickens in texas. | broilers from commercial flocks experiencing a 10-60% incidence of scabby-hip lesions at processing were examined, and selected skin lesions were cultured. over 70% of the lesions were associated with traumatic excoriations, particularly on the caudal dorsal convexity of the birds. most lesions were observed on birds that were 5 weeks of age or older. from the 27 specimens cultured, clostridium perfringens was isolated in pure culture from 4 lesions and staphylococcus species from 10 lesions. pu ... | 1989 | 2562194 |
| diarrhea associated with clostridium perfringens type a enterotoxin in neonatal pigs. | 1989 | 2562226 | |
| conserved sequences in bacterial and viral sialidases. | the genes of the bacterial sialidases from clostridium sordellii g12, c. perfringens a99, salmonella typhimurium lt-2 and vibrio cholerae 395 sequenced so far were examined for homologies and were compared with sequences of viral sialidases. each of the bacterial sialidases contains a short sequence of twelve amino-acids, which is repeated at four positions in the protein. all these sequences exhibit significant similarities. comparing the repeated sequences of the four sialidases, five amino-ac ... | 1989 | 2562507 |
| protein-losing enteropathy associated with clostridium perfringens infection. | 1989 | 2569066 | |
| case records of the massachusetts general hospital. weekly clinicopathological exercises. case 42-1989. a 64-year-old woman with a liver abscess, clostridium perfringens sepsis, progressive sensorimotor neuropathy, and abnormal serum proteins. | 1989 | 2571930 | |
| [clostridium infection in the puerperium following cesarean section]. | clostridium perfringens infections in the puerperal period are rare. a 22-year old patient, after caesarean section at another hospital, was admitted to our clinic showing clinical signs of haemolysis, slight uraemia, a crepitation of tissue and sonographical signs of air bubble formation in the uterus. since clostridium perfringens infections show a high mortality rate, early operative measures under high-dose penicillin treatment are indicated. in this case, hysterectomy and salpingectomy were ... | 1989 | 2583437 |
| peculiar acute toxic colitis after ingestion of colocynth: a clinicopathological study of three cases. | we report three examples of toxic acute colitis which occurred after ingestion of colocynth (citrullus colocynthis) for ritual purposes. the prominent clinical feature was dysenteric diarrhoea; colonoscopic changes included congestion and hyperaemia of the mucosa with abundant exudates but no ulceration or pseudopolyp formation. a causal relationship between colonic injury and the intake of colocynth was supported by the following features: (1) the pharmacology of the colocynth extract ingested; ... | 1989 | 2583569 |
| ciprofloxacin in patients with bacteremic infections. the spanish group for the study of ciprofloxacin. | the efficacy and safety of ciprofloxacin in the treatment of 68 episodes of bacteremia were studied. patients were treated intravenously (30 cases), orally (13 cases), or with sequential intravenous/oral therapy (25 cases). intravenous doses ranged from 200 to 400 mg per day and oral doses ranged from 1,000 to 1,500 mg per day. according to the criteria of mccabe and jackson, 39 cases had nonfatal and 29 had ultimately fatal underlying diseases. the clinical condition of patients at the start of ... | 1989 | 2589366 |
| activation of glucose transport in skeletal muscle by phospholipase c and phorbol ester. evaluation of the regulatory roles of protein kinase c and calcium. | it has been hypothesized on the basis of studies on bc3h-1 myocytes that diacylglycerol generation with activation of protein kinase c (pkc) is involved in the stimulation of glucose transport in muscle by insulin (standaert, m. l., farese, r. v., cooper, r. d., and pollet, r. j. (1988) j. biol. chem. 263, 8696-8705). in the present study, we used the rat epitrochlearis muscle to evaluate the possibility that pkc activity mediates the stimulation of glucose transport by insulin in mammalian skel ... | 1989 | 2600081 |
| [infectious diarrhea in the adult]. | infectious diarrhoeas are usually divided into two types; toxinogenic and invasive. invasive diarrhoeas are copious and responsible for dehydration which is the principal clinical sign; mucosal lesions and bacteraemia are absent. the most typical of toxinogenic diarrhoeas is cholera, but enterotoxicogenic e. coli and aeromonas infections have similar clinical features. in invasive diarrhoeas the responsible microorganisms penetrate into the epithelial cells of the intestine, producing fever and ... | 1989 | 2602888 |
| the bactericidal effect of isoascorbic acid combined with mild heat. | the thermal inactivation of salmonella thompson, escherichia coli, staphylococcus aureus, clostridium perfringens, candida zeylanoides, enterococcus faecium and e. faecalis was accelerated by the addition of sodium isoascorbate (1 mmol/l) to phosphate-buffer heating medium but not to complex food mixtures. the lethal effect of isoascorbate was nullified by heating under anaerobic conditions or by the addition of catalase. the scavengers of hydroxyl radicals, mannitol and formate were not protect ... | 1989 | 2613595 |
| [new probes for the analysis of membrane cholesterol--modified toxins which bind specifically to cholesterol molecules with no cytolytic effects]. | 1989 | 2614157 | |
| standardisation of quantitative direct gas liquid chromatography for early detection of bacteria in blood cultures. | blood cultures with strains of aerobic, facultative and obligate anaerobic bacteria were studied by quantitative direct gas liquid chromatography for early diagnosis of bacteraemias. small amounts of volatile and nonvolatile fatty acids were detected in uninoculated blood cultures. bacteroides fragilis produced acetic (27.6 mumol/ml), propionic (1.0 mumol/ml), isovaleric, (0.6 mumol/ml), lactic (4.5 mumol/ml) and succinic (2.7 mumol/ml) acids after 48 h. blood cultures inoculated with clostridiu ... | 1989 | 2620945 |
| comparison of bacteriologic culture of blood and necropsy specimens for determining the cause of foal septicemia: 47 cases (1978-1987) | diagnosis of bacterial septicemia was confirmed by results of bacteriologic culture of antemortem blood samples and/or necropsy specimens obtained from 47 foals up to 8 days old. gram-negative bacteria were isolated from all 47 foals, and mixed infections with more than one organism were involved in 26 (55%). escherichia coli, actinobacillus spp, and klebsiella pneumoniae were the most frequent isolates, infecting 55, 34, and 23% of foals, respectively. gram-positive bacteria and anaerobic bacte ... | 1989 | 2624660 |
| post-traumatic brain abscess with clostridium perfringens. | 1989 | 2642243 | |
| quality control guidelines for testing cefotetan in the reference agar dilution procedure for susceptibility testing of anaerobic bacteria. | reference values for quality control of in vitro susceptibility tests with cefotetan against anaerobic bacteria were determined in two independent multilaboratory studies with the approved national committee for clinical laboratory standards agar dilution method and three control strains (bacteroides fragilis atcc 25285, bacteroides thetaiotaomicron atcc 29741, and clostridium perfringens atcc 13124). the results of the two studies were in agreement. the recommended mic control limits for b. fra ... | 1989 | 2643621 |
| characterization of anaerobic bacteria by using a commercially available rapid tube test for glutamic acid decarboxylase. | a rapid glutamic acid decarboxylase microdilution test for presumptive identification of certain anaerobic bacteria was marketed recently by carr-scarborough microbiologicals, inc., stone mountain, ga. the test was evaluated with 474 clinical isolates, representing 11 genera and 54 species, and was found to be a useful aid in the presumptive identification of bacteroides fragilis, b. distasonis, b. vulgatus, b. thetaiotaomicron, b. ovatus, b. uniformis, b. eggerthii, clostridium perfringens, c. ... | 1989 | 2644301 |
| infectious diseases of new-world camelids (nwc). | although there are notable infectious conditions that are capable of producing clinical disease in the nwc, overall, these species are quite healthy. of the bacterial diseases, enterotoxemia caused by clostridium perfringens types c and d would be deemed the most significant in north america, while type a also would be regarded as important in south america. other important bacterial infections of potential concern are tuberculosis, johne's disease, anthrax, malignant edema, actinomycosis, tetan ... | 1989 | 2647231 |
| microbiological and compositional status of turkish white cheese. | results of the chemical and microbiological examination of 38 turkish white cheese samples are presented. on average, the cheese was characterized by a high moisture and salt content, 58.18 and 3.56%, respectively, and a ph of 4.68. significant variation was found in these compositional factors, indicating the extreme diversity of manufacturing practices. microbiological analysis revealed the presence of high numbers of coliforms, faecal coliforms and escherichia coli, extremely high numbers of ... | 1989 | 2701567 |
| the regulation of platelet-activating factor production in endothelial cells. the role of calcium and protein kinase c. | endothelial cells (ec) synthesize platelet-activating factor (paf) when stimulated with agonists that bind to cell-surface receptors. we examined events that link receptor binding to synthesis of paf by ec. bovine ec stimulated with agonists that interact with specific cell-surface receptors accumulated paf only in the presence of extracellular calcium. hormonal stimulation of ec resulted in ca2+ entry characteristic of that seen with receptor-operated calcium channels; indo-1 measurements demon ... | 1989 | 2703492 |
| the detection of clostridium perfringens epsilon antitoxin in rabbit serum by monoclonal antibody based competition elisa. | a competitive enzyme-linked immunosorbent assay (celisa) has been developed, standardized and compared with the toxin neutralization (tn) test performed in mice for the measurement of antibody responses in rabbits vaccinated with clostridial vaccines. in celisa, sera were tested at a single dilution for their ability to compete with the reaction between a monoclonal antibody, which neutralizes epsilon toxin, and epsilon toxoid coated on to a solid phase. the results of the two tests correlated w ... | 1989 | 2715150 |
| dissociation of various biological activities of clostridium perfringens alpha toxin by chemical modification. | the effect of n-acetylimidazole, tetranitromethane, maleic anhydride and n-ethylmaleimide on various biological activities of clostridium perfringens alpha (alpha)-toxin was investigated. treatment of the toxin with n-acetylimidazole, tetranitromethane or maleic anhydride resulted in significant reduction of lethal, hemolytic and platelet-aggregating activities and phospholipase c activity (ey activity), as measured by increased turbidity in egg yolk emulsions. however, ey activity was more resi ... | 1989 | 2728024 |
| [the "diseased" or "dead" guillemots (uria aalge), three-toed gulls (rissa tridactyla), silver gulls (larus argentatus) and laughing gulls (larus ridibundus) found in the area of the german bay, 1982-1985]. | between 1982 and 1985 the cadavers of 50 guillemots (uria aalge), 41 kittiwakes (rissa tridactyla), 26 herring gulls (larus argentatus) and 34 black-headed gulls (larus ridibundus) were examined pathological, bacteriological and virological. the probable cause of death was established. parasitosis were particularly prevalent in herring gulls (49%), where the main infection--as in black-headed gulls--was with cestoides. in kittiwakes and guillemots mainly spiruroideae were recorded. the commonest ... | 1989 | 2752934 |
| microbial contamination of cosmetics and personal care items in egypt--body lotions and talcum powders. | we examined a total of 54 samples, including 18 body lotions and 36 talcum powders, for their total aerobic bacterial, coliform and fungal counts. we also carried out anaerobic bacterial counts for talcum powder as well as tests to detect some potentially hazardous bacteria in all tested samples. talcum powders were more heavily contaminated with bacteria and fungi than body lotions. more than 40% of the tested body lotions contained no viable bacteria or less than 100 c.f.u./g. while all the ta ... | 1989 | 2760119 |
| sialidase from different sources compared for electrophoretically separating serum alkaline phosphatase fractions from liver and bone. | we compared sialidase (neuraminidase; ec 3.2.1.18) from vibrio cholerae, clostridium perfringens, and arthrobacter ureafaciens, seeking to improve the electrophoretic separation of the liver and bone isoenzymes of alkaline phosphatase (ec 3.1.3.1) on cellulose acetate membranes. resolution is decisively determined by the type and activity of sialidase used in the preincubation of serum sample. sialidase from arthrobacter ureafaciens is not suited for this method. for optimal separation of the tw ... | 1989 | 2776324 |
| the antibody response of normal mice to immunization with single-stranded dna of various species origin. | to further assess the mechanism for the induction of anti-dna antibodies, the response of balb/c mice to immunization with single-stranded dna of various species origin was determined. anti-dna levels of mice immunized with escherichia coli dna as complexes with methylated bsa in adjuvant were significantly greater by elisa than those from mice immunized similarly with calf thymus dna. furthermore, comparison of the responses of mice immunized with complexes of dna from calf thymus, chicken bloo ... | 1989 | 2785884 |
| influence of peas (pisum sativum) as a dietary ingredient and flavomycin supplementation on the performance and intestinal microflora of broiler chicks. | 1. two experiments were carried out to study the effects of diets containing various concentrations of pea meal (pisum sativum l.), with or without flavomycin supplementation, on the performance and intestinal microflora of broiler chicks. 2. during the 7 to 28-d period, chicks fed on diets containing 300, 600 and 800 g pea meal/kg consumed more food and gained more weight than chicks receiving a maize-isolated soyabean protein control diet. the addition of flavomycin to the diets had similar ef ... | 1989 | 2787194 |
| comparative in vitro activity of lomefloxacin, a difluoro-quinolone. | lomefloxacin is a new difluoro-quinolone. in this study, we have determined the in vitro activity of lomefloxacin against a wide range of clinical bacterial isolates and compared it with that of other fluoro-quinolones and some unrelated antimicrobials. lomefloxacin was very active against enterobacteriaceae (mic90, 0.5 micrograms/ml) with activity comparable to that of ofloxacin (mic90, 0.25 micrograms/ml). lomefloxacin was moderately active against isolates of pseudomonas aeruginosa (mic90, 4 ... | 1989 | 2791500 |
| in vitro and in vivo antibacterial activities of at-4140, a new broad-spectrum quinolone. | at-4140, 5-amino-1-cyclopropyl-6,8-difluoro-1,4-dihydro-7-(cis-3,5- dimethyl-1-piperazinyl)-4-oxoquinoline-3-carboxylic acid, showed broad and potent antibacterial activity. its mics for 90% of the strains tested were 0.1 to 0.78 micrograms/ml against gram-positive organisms, such as members of the genera staphylococcus, streptococcus, and enterococcus, and 0.0125 to 1.56 micrograms/ml against gram-negative organisms, such as members of the family enterobacteriaceae and the genera pseudomonas, b ... | 1989 | 2802544 |
| cloning and sequencing of the clostridium perfringens enterotoxin gene. | several gene banks of clostridium perfringens in e. coli were constructed. using a mixture of synthetic 29-mer dna probes clones were selected containing inserts from the c. perfringens gene coding for the enterotoxin. this has allowed sequencing of the complete gene and its flanking regions. the decuded amino acid sequence (320 a.a.) was found to differ at several sites from the sequence published previously by others. two 40-mer dna-probes were used to detect the toxin gene in c. perfringens s ... | 1989 | 2802575 |
| the growth-inhibitory properties of meropenem against anaerobes of clinical importance. | the in-vitro activity of meropenem against anaerobic bacteria was assessed by an agar dilution procedure. mics were measured for 449 clinical isolates and reference strains. meropenem showed excellent activity against both gram-negative anaerobes, including bacteroides fragilis (mic90 0.25 mg/l), and gram-positive anaerobes. the mic90 for clostridium perfringens was 0.01 mg/l. meropenem had comparable activity to imipenem against gram-negative anaerobes but was more active than imipenem against ... | 1989 | 2808203 |
| detection of bacterial cell wall hydrolases after denaturing polyacrylamide gel electrophoresis. | cell walls from various gram-positive bacteria were incorporated at a concentration of 0.2% (w/v) into polyacrylamide gels as a substrate for detection of cell wall hydrolases. bacterial extracts from crude cell wall preparations were denatured with sodium dodecyl sulfate and 2-mercaptoethanol and subjected to denaturing polyacrylamide gel electrophoresis in gels containing bacterial cell walls. after renaturation in the presence of purified and buffered 1% (v/v) triton x-100, cell wall hydrolas ... | 1989 | 2819603 |
| comparison of the structural characteristics of cell-cam 105 from hepatocytes with those of an altered form expressed by rat transplantable hepatocellular carcinomas. | the structural features of the adult rat hepatocyte (arh) forms of cell-cam 105, a mr 105,000 cell adhesion molecule, were compared using a variety of immunochemical and biochemical techniques with altered forms of more basic pi present on two transplantable hepatocellular carcinomas (thc 1682c and thc as-30d). immunoprecipitation analysis with polyclonal (anti-gp 105-2) and monoclonal (mab) antibodies specific for cell-cam 105 (mab 362.50) demonstrated that arh and thc cell-cam 105 were indisti ... | 1989 | 2819719 |