Publications

TitleAbstractYear
Filter
PMID(sorted ascending)
Filter
microbial oxidation of gaseous hydrocarbons: epoxidation of c2 to c4 n-alkenes by methylotrophic bacteria.over 20 new cultures of methane-utilizing microbes, including obligate (types i and iii) and facultative methylotrophic bacteria were isolated. in addition to their ability to oxidize methane to methanol, resting cell-suspensions of three distinct types of methane-grown bacteria (methylosinus trichosporium ob3b [type ii, obligate]; methylococcus capsulatus crl m1 nrrl b-11219 [type i, obligate]; and methylobacterium organophilum crl-26 nrrl b-11222 [facultative]) oxidize c2 to c4 n-alkenes to th ...197939502
alcohol dehydrogenase from methylobacterium organophilum.the alcohol dehydrogenase from methylobacterium organophilum, a facultative methane-oxidizing bacterium, has been purified to homogeneity as indicated by sodium dodecyl sulfate-gel electrophoresis. it has several properties in common with the alcohol dehydrogenases from other methylotrophic bacteria. the active enzyme is a dimeric protein, both subunits having molecular weights of about 62,000. the enzyme exhibits broad substrate specificity for primary alcohols and catalyzes the two-step oxidat ...197880974
intracytoplasmic membrane, phospholipid, and sterol content of methylobacterium organophilum cells grown under different conditions.intracytoplasmic membranes were present in methylobacterium organophilum when cells were grown with methane, but not methanol or glucose, as the sole carbon and energy source. cells grown with methane as the carbon and energy source and low levels of dissolved oxygen had the greatest amount of intracytoplasmic membrane. cells grown with increased levels of dissolved oxygen had less intracytoplasmic membrane. the amount of total lipid correlated with the amount of membrane material observed in th ...197896093
genetic transformation in methylobacterium organophilum.several mutants have been isolated from the facultative methylotroph, methylobacterium organophilum, using either n-methyl-n'-nitro-n-nitrosoguanidine or ultraviolet light as mutagens. one of these isolates, a glutamate auxotroph lacking isocitrate dehydrogenase, has been transformed to prototrophy, using wild-type dna, at a frequency of 0-5%. competence and dna uptake occur only in cultures which are near the end of exponential growth, and maximal transformation requires a dna concentration of ...1977401866
the interaction of methanol dehydrogenase and its electron acceptor, cytochrome cl in methylotrophic bacteria.the interactions of methanol dehydrogenase (mdh, ec1.1.99.8) with its specific electron acceptor cytochrome cl has been investigated in methylobacterium extorquens and methylophilus methylotrophus. the mdhs of these two very different methylotrophs have the same alpha 2 beta 2 structure; the interaction of these mdhs with their specific electron acceptor, cytochrome cl, has been studied using a novel assay system. electrostatic reactions are involved in 'docking' of the two proteins. edta inhibi ...19921311606
the three-dimensional structures of methanol dehydrogenase from two methylotrophic bacteria at 2.6-a resolution.the structures of methanol dehydrogenase (medh) from two closely related methylotrophic bacteria, methylophilus methylotrophus and w3a1, have been determined at 2.6-a resolution. the molecule, a quinoprotein of molecular mass of about 138 kda, contains two heavy (h) and two light (l) subunits of unknown sequence and two molecules of noncovalently associated pyrroloquinoline quinone. the two enzymes crystallize isomorphously in space group p2(1) with one h2l2 heterotetramer in the asymmetric unit ...19921331050
characterization of mutant forms of the quinoprotein methanol dehydrogenase lacking an essential calcium ion.methanol dehydrogenase (mdh) from methylobacterium extorquens, methylophilus methylotrophus, paracoccus denitrificans and hyphomicrobium x all contained a single atom of ca2+ per alpha 2 beta 2 tetramer. the role of ca2+ was investigated using the mdh from methylobacterium extorquens. this was shown to be similar to the mdh from hyphomicrobium x in having 2 mol of prosthetic group (pyrroloquinoline quinine; pqq) per mol of tetramer, the pqq being predominantly in the semiquinone form. mdh isolat ...19921332681
localization of methanol dehydrogenase in two strains of methylotrophic bacteria detected by immunogold labeling.antibodies to methanol dehydrogenase purified from methylobacterium sp. strain am1 and methylomonas sp. strain a4 were raised. the antibody preparations were used in indirect immunogold labeling studies. with this approach, methanol dehydrogenase was found to be preferentially localized to the periplasmic region of the methylotroph methylobacterium sp. strain am1 and to the intracytoplasmic membrane of the methanotroph methylomonas sp. strain a4. antibody cross-reactivity to other methylotrophic ...19921365400
susceptibility testing of clinical isolates of methylobacterium species.methylobacterium species represent a relatively new genus which is being increasingly isolated from cases of opportunistic infections. this study reports on 3 reference strains and 15 clinical isolates of methylobacterium species. susceptibility tests were performed by the agar dilution and commercial broth microdilution methods at both 30 and 35 degrees c. readings were made at 24, 48, and 72 h. incubation conditions of 48 h and 30 degrees c were found to be optimum. both the agar dilution and ...19921416844
an evolutionary perspective on glutathione transferases inferred from class-theta glutathione transferase cdna sequences.we report the cdna sequence for rat glutathione transferase (gst) subunit 5, which is one of at least three class theta subunits in this species. this sequence, when compared with that of subunit 12 recently published by ogura, nishiyama, okada, kajita, narihata, watabe, hiratsuka & watabe [(1991) biochem. biophys. res. commun. 181, 1294-1300] proves that theta is a separate multigene class of gst with little amino acid sequence identity with mu-, alpha- or pi-class enzymes. the amino acid seque ...19921445253
crystallization and preliminary crystallographic investigation of methanol dehydrogenase from methylobacterium extorquens am1.single crystals of methanol dehydrogenase (mdh) from methylobacterium extorquens am1 have been grown by the vapour diffusion method. these crystals diffract to beyond 2 a resolution and are suitable for x-ray crystallography. they belong to the orthorhombic space group p2(1)2(1)2(1) and have the following unit cell parameters: a = 66.79 a, b = 108.9 a, c = 188.9 a. one asymmetric unit contains an alpha 2 beta 2 tetramer of mdh and the location of the non-crystallographic 2-fold symmetry axis of ...19921447790
molecular basis for biosynthesis and accumulation of polyhydroxyalkanoic acids in bacteria.the current knowledge on the structure and on the organization of polyhydroxyalkanoic acid (pha)-biosynthetic genes from a wide range of different bacteria, which rely on different pathways for biosynthesis of this storage polyesters, is provided. molecular data will be shown for genes of alcaligenes eutrophus, purple non-sulfur bacteria, such as rhodospirillum rubrum, purple sulfur bacteria, such as chromatium vinosum, pseudomonads belonging to rrna homology group i, such as pseudomonas aerugin ...19921476773
growth and enzymological characteristics of a pink-pigmented facultative methylotroph methylobacterium sp. mb1.growth characteristics of batch and continuous cultures of the pink facultative methylotroph methylobacterium sp. mb1 were determined. the response of a chemostat culture to a pulse increase of methanol concentration was studied. malate, succinate and oxaloacetate additions to the methanol-supplemented medium decreased batch culture growth inhibition by methanol. the carotenoid content in cells grown in a chemostat decreased with increasing growth rate. the key enzyme activities of c1-metabolism ...19921505877
topology fingerprint approach to the inverse protein folding problem.we describe the most general solution to date of the problem of matching globular protein sequences to the appropriate three-dimensional structures. the screening template, against which sequences are tested, is provided by a protein "structural fingerprint" library based on the contact map and the buried/exposed pattern of residues. then, a lattice monte carlo algorithm validates or dismisses the stability of the proposed fold. examples of known structural similarities between proteins having w ...19921522587
reactions of benzylamines with methylamine dehydrogenase. evidence for a carbanionic reaction intermediate and reaction mechanism similar to eukaryotic quinoproteins.it had been previously reported that aromatic amines were not substrates for the bacterial quinoprotein methylamine dehydrogenase. in this study, benzylamine-dependent activity was also not observed in the steady-state assay of this enzyme with the artificial electron acceptor phenazine ethosulfate (pes). benzylamines did, however, stoichiometrically reduce the protein-bound tryptophan tryptophylquinone (ttq) prosthetic group and acted as reversible competitive inhibitors of methylamine oxidatio ...19921554720
evaluation of the 4-hour rapid nf plus method for identification of 345 gram-negative nonfermentative rods.the ability of the rapid nf plus system (innovative diagnostic systems, inc., atlanta, ga.) to identify 345 nonfermentative gram-negative rods was evaluated. kits were inoculated with no. 1 mcfarland suspensions, and reactions were interpreted after a 4-h incubation at 35 degrees c. overall, the method correctly identified 311 strains (90.1%) without additional tests and 21 strains (6.1%) with additional tests, and 13 strains (3.8%) were misidentified. five of 13 misidentified strains were alcal ...19921583129
a pseudo-outbreak of methylobacterium mesophilica isolated from patients undergoing bronchoscopy.an unusual, slow growing, pink-pigmented gram-negative bacillus was isolated from bronchoscopy specimens of seven patients over a three-month period. the organism was identified as methylobacter mesophilica. none of the patients were believed to be infected with methylobacter mesophilica. the results of environmental cultures showed that the organism was present in tap water from the bronchoscopy room.19921597201
crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin.the crystal structure of the complex between the quinoprotein methylamine dehydrogenase (madh) and the type i blue copper protein amicyanin, both from paracoccus denitrificans, has been determined at 2.5-a resolution using molecular replacement. the search model was madh from thiobacillus versutus. the amicyanin could be located in an averaged electron density difference map and the model improved by refinement and model building procedures. nine beta-strands are observed within the amicyanin mo ...19921599920
catheter infection caused by methylobacterium in immunocompromised hosts: report of three cases and review of the literature.three cases of catheter infection due to methylobacterium extorquens are reported. each patient had a history of acute leukemia and was immunocompromised; two had undergone bone marrow transplantation, and the third was receiving consolidation chemotherapy. all three patients survived after removal of the central venous catheter and antibiotic treatment. the clinical features of these cases are compared with those of the 12 previously reported cases of infection due to methylobacterium species.19921600002
methods to identify and avoid artifactual formation of interchain disulfide bonds when analyzing proteins by sds-page.amicyanin is a monomeric protein of known structure which possesses a single cysteine that serves as a ligand to copper in its native state. sodium dodecyl sulfate polyacrylamide gel electrophoresis (sds-page) analysis of amicyanin after denaturation in the presence and absence of beta-mercaptoethanol, however, indicated that this protein was a dimer which was covalently linked by interchain disulfide bonds. this artifact was caused by exposure during denaturation of the free cysteine that norma ...19921616709
cloning of a methanol-inducible moxf promoter and its analysis in moxb mutants of methylobacterium extorquens am1rif.in methylobacterium extorquens am1, gene encoding methanol dehydrogenase polypeptides are transcriptionally regulated in response to c1 compounds, including methanol (m. e. lidstrom and d. i. stirling, annu. rev. microbiol. 44:27-57, 1990). in order to study this regulation, a transcriptional fusion has been constructed between a beta-galactosidase reporter gene and a 1.55-kb xhoi-sali fragment of m. extorquens am1rif dna encoding the n terminus of the methanol dehydrogenase large subunit (moxf) ...19921624436
genetic organization of methylamine utilization genes from methylobacterium extorquens am1.an isolated 5.2-kb fragment of methylobacterium extorquens am1 dna was found to contain a gene cluster involved in methylamine utilization. analysis of polypeptides synthesized in an escherichia coli t7 expression system showed that five genes were present. two of the genes encoded the large and small subunits of methylamine dehydrogenase, and a third encoded amicyanin, the presumed electron acceptor for methylamine dehydrogenase, but the function of the other two genes is not known. the order o ...19911653226
isolation and characterization of the moxj, moxg, moxi, and moxr genes of paracoccus denitrificans: inactivation of moxj, moxg, and moxr and the resultant effect on methylotrophic growth.by using the moxf gene encoding the large fragment of methanol dehydrogenase as a probe, a downstream linked chromosomal fragment was isolated from a genomic bank of paracoccus denitrificans. the nucleotide sequence of the fragment was determined and revealed the 3' part of moxf, four additional open reading frames, and the 5' part of a sixth one. the organization and deduced amino acid sequences of the first three frames downstream from moxf were found to be largely homologous to the moxj, moxg ...19911657871
isolation, sequencing, and mutagenesis of the gene encoding cytochrome c553i of paracoccus denitrificans and characterization of the mutant strain.the periplasmically located cytochrome c553i of paracoccus denitrificans was purified from cells grown aerobically on choline as the carbon source. the purified protein was digested with trypsin to obtain several protein fragments. the n-terminal regions of these fragments were sequenced. on the basis of one of these sequences, a mix of 17-mer oligonucleotides was synthesized. by using this mix as a probe, the structural gene encoding cytochrome c553i (cycb) was isolated. the nucleotide sequence ...19911657873
purification and characterization of hydroxypyruvate reductase from the facultative methylotroph methylobacterium extorquens am1.hydroxypyruvate reductase was purified to homogeneity from the facultative methylotroph methylobacterium extorquens am1. it has a molecular mass of about 71 kda, and it consists of two identical subunits with a molecular mass of about 37 kda. this enzyme uses both nadh (km = 0.04 mm) and nadph (km = 0.06 mm) as cofactors, uses hydroxypyruvate (km = 0.1 mm) and glyoxylate (km = 1.5 mm) as the only substrates for the forward reaction, and carries out the reverse reaction with glycerate (km = 2.6 m ...19911657886
complementation of methylobacterium organophilum mutants affected in pyrroloquinoline quinone biosynthesis genes pqqe and pqqf by cloned escherichia coli chromosomal dna.the hybrid plasmid pbgt3, a derivative of pla2917 containing a 7.8-kb fragment of escherichia coli dna, was found to complement pqqe and pqqf mutants of methylobacterium organophilum, both impaired in pqq biosynthesis. the cloned fragment of e. coli dna did not hybridize with dna fragments containing pqqe or pqqf previously cloned from m. organophilum. yet, in m. organophilum mutants, expression of pqqe and pqqf genes from e. coli resulted in a pqq production estimated at 9-16% of the production ...19911663886
16s ribosomal rna sequence analysis for determination of phylogenetic relationship among methylotrophs.16s ribosomal rnas (rrna) of 12 methylotrophic bacteria have been almost completely sequenced to establish their phylogenetic relationships. methylotrophs that are physiologically related are phylogenetically diverse and are scattered among the purple eubacteria (class proteobacteria). group i methylotrophs can be classified in the beta- and the gamma-subdivisions and group ii methylotrophs in the alpha-subdivision of the purple eubacteria, respectively. pink-pigmented facultative and non-pigmen ...19901693657
cloning, mutagenesis, and physiological effect of a hydroxypyruvate reductase gene from methylobacterium extorquens am1.the gene encoding the serine cycle hydroxypyruvate reductase of methylobacterium extorquens am1 was isolated by using a synthetic oligonucleotide with a sequence based on a known n-terminal amino acid sequence. the cloned gene was inactivated by insertion of a kanamycin resistance gene, and recombination of this insertion derivative with the wild-type gene produced a serine cycle hydroxypyruvate reductase null mutant. this mutant had lost its ability to grow on c-1 compounds but retained the abi ...19921729225
resonance effects in strongly exothermic long-range electron transfer and their possible implications for the behaviour of site-directed mutant proteins.long-range electron transfer investigations of hemoproteins, blue copper and iron-sulphur proteins frequently rest on electronically excited metal centres. when the excitation energy approaches the oxidation or reduction potentials of intermediate residues the superexchange view normally used, however, fails and a variety of new dynamic features arise. these all involve population of the intermediate cation or anion residue states which can be partially or wholly vibrationally relaxed. we discus ...19921733768
cloning, sequencing and expression studies of the genes encoding amicyanin and the beta-subunit of methylamine dehydrogenase from thiobacillus versutus.the genes encoding amicyanin and the beta-subunit of methylamine dehydrogenase (madh) from thiobacillus versutus have been cloned and sequenced. the organization of these genes makes it likely that they are coordinately expressed and it supports earlier findings that the blue copper protein amicyanin is involved in electron transport from methylamine to oxygen. the amino acid sequence deduced from the nucleotide sequence of the amicyanin-encoding gene is in agreement with the published protein s ...19911765062
[the autoselection of neustonic forms of bacteria].self-breeding of neuston forms of methylobacterium sp., pseudomonas putida bc-2, alcaligenes paradoxus bc-1, bacillus thuringiensis var. israilensis bacteria as well as of a mixed culture of methylotrophs is shown possible. in spite of ability of hydrophobicity of the cell surface the suggested method of self-breeding may be used to perfect properties of larvicidal biopreparations, and bacterial preparations which intensify self-purification of water bodies.19911791780
characterization of new plasmids from methylotrophic bacteria.several tens of methanol-utilizing bacterial strains isolated from soil were screened for the presence of plasmids. from the obligate methylotroph methylomonas sp. strain r103a plasmid pih36 (36 kb) was isolated and its restriction map was constructed. in pink-pigmented facultative methylotrophs (ppfm), belonging to the genus methylobacterium four plasmids were detected: plasmids pib200 (200 kb) and pib14 (14 kb) in the strain r15d and plasmids pwu14 (14 kb) and pwu7 (7.8 kb) in the strain m17. ...19911796807
nucleotide sequence of the amicyanin gene from methylobacterium extorquens am1.the gene for amicyanin from the methylotrophic bacterium, methylobacterium extorquens am1 was identified. it encodes a protein consisting of 119 amino acids with a molecular weight of 12,609 kda. the amino acid sequence shows the presence of a typical leader sequence and signal peptidase recognition site. two putative hairpin structures were found, one located directly behind the amicyanin gene and another located 50 bp upstream. the same sequence aaaatccc was found near the start codons for the ...19911802036
transformation of a methylotrophic bacterium, methylobacterium extorquens, with a broad-host-range plasmid by electroporation.electroporation was used to transform the methylotrophic bacterium methylobacterium extorquens with broad-host-range plasmid pla2917, which contains a gene specifying resistance to kanamycin. plasmid dna was introduced into m. extorquens in the presence of an electric pulse, and kanamycin-resistant transformants were obtained. these transformants harbored plasmid dna that was identical to plasmid pla2917. we examined several factors independently and found up to 8 x 10(3) transformants per micro ...19911809210
theta, a new class of glutathione transferases purified from rat and man.glutathione transferases (gsts) of a novel class, which it is proposed to term theta, were purified from rat and human liver. two, named gst 5-5 and gst 12-12, were obtained from the rat, and one, named gst theta, was from the human. unlike other mammalian gsts they lack activity towards 1-chloro-2,4-dinitrobenzene and are not retained by gsh affinity matrices. only gst 5-5 retains full activity during purification, and its activities towards the substrates 1,2-epoxy-3-(p-nitrophenoxy)propane, p ...19911848757
electron transfer in proteins: in search of preferential pathways.electron migration between and within proteins is one of the most prevalent forms of biological energy conversion processes. electron transfer reactions take place between active centers such as transition metal ions or organic cofactors over considerable distances at fast rates and with remarkable specificity. the electron transfer is attained through weak electronic interaction between the active sites, so that considerable research efforts are centered on resolving the factors that control th ...19911868979
the amino acid sequence of rusticyanin isolated from thiobacillus ferrooxidans.the amino acid sequence of rusticyanin, a copper protein, purified from the iron-oxidizing bacterium thiobacillus ferrooxidans was determined. rusticyanin contained 154 amino acid residues in a single polypeptide chain and its molecular weight was calculated to be about 16,400 based on the amino acid sequence. the n-terminal sequence up to the 20th residue of the protein apparently resembled those of methylobacterium extorquens am1 amicyanin and poplar leaf plastocyanin rather than those of azur ...19911879547
the small-subunit polypeptide of methylamine dehydrogenase from methylobacterium extorquens am1 has an unusual leader sequence.the nucleotide sequence for the n-terminal region of the small subunit of methylamine dehydrogenase from methylobacterium extorquens am1 has revealed a leader sequence that is unusual in both its length and composition. gene fusions to lacz and phoa show that this leader sequence does not function in escherichia coli but does function in m. extorquens am1.19911885555
resonance raman spectra of plastocyanin and pseudoazurin: evidence for conserved cysteine ligand conformations in cupredoxins (blue copper proteins).new resonance raman (rr) spectra at 15 k are reported for poplar (populus nigra) and oleander (oleander nerium) plastocyanins and for alcaligenes faecalis pseudoazurin. the spectra are compared with those of other blue copper proteins (cupredoxins). in all cases, nine or more vibrational modes between 330 and 460 cm-1 can be assigned to a coupling of the cu-s(cys) stretch with cys ligand deformations. the fact that these vibrations occur at a relatively constant set of frequencies is testimony t ...19911932014
assignment of the 600-mhz 1h-nmr spectrum of amicyanin from thiobacillus versutus by two-dimensional nmr methods provides information on secondary structure.the nearly complete assignment (ph 6.8; t 310 k) of the 1h-nmr spectrum of reduced amicyanin from thiobacillus versutus is reported. experimental evidence is presented, that the structure of the amicyanin contains two beta-sheets, a feature common to plastocyanins and azurins. the loops joining the beta-strands have also been identified. the loop f-g (thr94-phe98), together with the flanking residues cys93 and met99, comprises three of the four copper ligands and is short compared to similar loo ...19911935963
identification of dcmr, the regulatory gene governing expression of dichloromethane dehalogenase in methylobacterium sp. strain dm4.the genes for dichloromethane utilization by methylobacterium sp. strain dm4 are encoded on a 2.8-kb sequenced dna fragment, the dcm region. this fragment contains dcma, the structural gene of dichloromethane dehalogenase and, upstream of dcma, a 1.5-kb region responsible for inducibility of dichloromethane dehalogenase by dichloromethane. a fragment of the dcm region covering dcma and 230 bp of its upstream region was integrated into the chromosome of a methylobacterium sp. strain dm4 mutant de ...19911938878
major antigens in methylobacterium species and their location in cells using immuno-electron microscopic methods.this work is a first step in the development of a specific probe for the study of the distribution and colonization of leaf surfaces by pink-pigmented, facultatively methylotrophic (ppfm) bacteria of the genus methylobacterium. a polyclonal antiserum was produced in rabbits against whole cells of ppfm strain pc1, isolated from surfaces of white clover leaves. major heat labile antigens were found in extracts of sonicated cells using the ouchterlony double diffusion method. very small amounts of ...19911954784
intrinsic fluorescence of the bacterial copper-containing protein amicyanin.the fluorescence properties of the single tryptophanyl residue present in amicyanin from thiobacillus versutus are very similar to those of azurin from pseudomonas aeruginosa and other mononuclear blue copper proteins. the emission maximum is well structured and centered at 318 nm. the quantum yield is strongly affected by the presence of copper, the removal of which is accompanied by a more than sixfold increase in fluorescence, without change in shape. the fluorescence decay of holo-amicyanin ...19911989489
exafs analysis of the ph dependence of the blue-copper site in amicyanin from thiobacillus versutus.the room temperature cu k-edge exafs (extended x-ray absorption fine structure) spectrum of reduced and oxidized amicyanin, the blue copper protein from thiobacillus versutus, was measured at low and high ph. the data interpretation was partly based on independent nmr evidence for the occurrence of a ligand histidine protonation at low ph (pka = 6.9) in the reduced protein. in the oxidized protein two nitrogen-donors (from two histidines; cu-n distances 1.95-2.01 a and 1.86-1.89 a) and a sulfur- ...19912001393
the structural homology of amicyanin from thiobacillus versutus to plant plastocyanins.the complete amino acid sequence of the blue copper protein amicyanin of thiobacillus versutus, induced when the bacterium is grown on methylamine, has been determined as follows: qdkitvtsekpvaaadvpadavvvgiekmkyltpevtikagetvywvngevmphnva fkkgivgedafrgemmtkdqayaitfneagsydyfctphpfmrgkvive. the four copper ligand residues in this 106-residue-containing polypeptide chain are his54, cys93, his96, and met99. the thiobacillus amicyanin is 52% similar to the amicyanin of pseudomonas am1, the only other ...19912002033
preliminary crystallographic study of a pseudoazurin from methylotrophic bacterium, methylobacterium extorquens am1.single crystals of pseudoazurin, one of the blue copper proteins produced by methylotrophic bacterium methylobacterium extorquens am1, have been obtained by the method of vapor diffusion with ammonium sulfate as a precipitant at ph 8.0. crystals belong to the orthorhombic system, space group p2(1)2(1)2(1), with unit cell dimensions of a = 52.619(4) a, b = 63.280(6) a, c = 35.133(4) a. the asymmetric unit includes one molecule of pseudoazurin (vm = 2.18 a3/dalton). the crystals are so stable agai ...19912002502
a new cofactor in a prokaryotic enzyme: tryptophan tryptophylquinone as the redox prosthetic group in methylamine dehydrogenase.methylamine dehydrogenase (madh), an alpha 2 beta 2 enzyme from numerous methylotrophic soil bacteria, contains a novel quinonoid redox prosthetic group that is covalently bound to its small beta subunit through two amino acyl residues. a comparison of the amino acid sequence deduced from the gene sequence of the small subunit for the enzyme from methylobacterium extorquens am1 with the published amino acid sequence obtained by the edman degradation method, allowed the identification of the amin ...19912028257
dynamic fluorescence in copper proteins. selected examples.the fluorescence properties of three copper proteins, namely human superoxide dismutase, pseudomonas aeruginosa azurin and thiobacillus versutus amicyanin have been studied. all these proteins show a non-exponential decay of fluorescence, though the tryptophanyl residues responsible for the emission are very differently located in the three proteins. all the three decays can be fitted by at least two lifetimes or better with one or two lorentzian-shaped, continuous distributions of lifetime. in ...19902096899
sequence analysis and expression of the bacterial dichloromethane dehalogenase structural gene, a member of the glutathione s-transferase supergene family.the nucleotide sequence of a cloned 2.8-kilobase-pair bamhi-psti fragment containing dcma, the dichloromethane dehalogenase structural gene from methylobacterium sp. strain dm4, was determined. an open reading frame with a coding capacity of 287 amino acids (molecular weight, 37,430) was identified as dcma by its agreement with the n-terminal amino acid sequence, the total amino acid composition, and the subunit size of the purified enzyme. alignment of the deduced dichloromethane dehalogenase a ...19902104602
nucleotide sequence of the methylobacterium extorquens am1 moxf and moxj genes involved in methanol oxidation.the nucleotide sequence has been determined for two genes involved in methanol oxidation in the facultative methylotroph, methylobacterium extorquens am1. the two genes are moxf, encoding the 66-kda subunit of the methanol dehydrogenase and moxj, located immediately downstream from moxf, which encodes a 30-kda protein with unknown function. this information completes the sequence of the 5.86-kb xhoi-sali fragment containing the moxfjgi region in m. extorquens am1, and the structure of this gene ...19902116368
cloning and sequencing of the structural gene for the small subunit of methylamine dehydrogenase from methylobacterium extorquens am1: evidence for two tryptophan residues involved in the active center.in two independent clone libraries, clones were identified that hybridized with oligonucleotide probes based on n- or c-terminal polypeptide sequence of the small subunit of methylamine dehydrogenase from methylobacterium extorquens am1. plasmids from all clones had in common a 5.2 kb bam hi-hindiii dna fragment. a 0.57 kb sacii-bcli subfragment that hybridized to the oligonucleotide probes was sequenced. nucleotide sequence analysis coincided with polypeptide sequence data in the structural par ...19902121141
genetics of carbon metabolism in methylotrophic bacteria.the application of genetic techniques to the methylotrophic bacteria has greatly enhanced studies of these important organisms. two methylotrophic systems have been studied in some detail, the serine cycle for formaldehyde assimilation and the methanol oxidation system. in both cases, genes have been cloned and mapped in methylobacterium species (facultative serine cycle methanol-utilizers). in addition, methanol oxidation genes have been studied in an autotrophic methanol-utilizer (paracoccus d ...19902128803
characterization of a novel soluble c-type cytochrome in a moxd mutant of methylobacterium extorquens am1.methylobacterium extorquens am1 contains a novel c-type cytochrome, called cytochrome c-553, previously thought to be a precursor of the electron acceptor (cytochrome cl) for methanol dehydrogenase. its amino acid composition and serological characteristics show that it has no structural relationship to cytochrome cl. it usually comprises less than 5% of the total c-type cytochromes. in a moxd mutant, which contains neither methanol dehydrogenase nor cytochrome cl, it comprises 30% of the solubl ...19902161900
the methanol-oxidizing system of methylobacterium extorquens am1 reconstituted with purified constituents.the electron transport system (with cytochrome aa3) coupled to the oxidation of methanol in methylobacterium extorquens am1 (former pseudomonas am1) was reconstituted with highly purified constituents of the system. a mixture of 2.7 microm methanol dehydrogenase, 3.2 microm cytochrome ch, and 71 nm cytochrome c oxidase (= cytochrome aa3) consumed oxygen at a lower rate in the presence of methanol, while its activity was enhanced 3-fold by the addition of 1.4 microm cytochrome cl (74 mol of o2 co ...19902168871
mutagenesis of the gene encoding amicyanin of paracoccus denitrificans and the resultant effect on methylamine oxidation.the gene encoding the blue-copper protein amicyanin was isolated from a genomic bank of paracoccus denitrificans by using a synthetic oligonucleotide. it is located directly downstream of the gene encoding the small subunit of methylamine dehydrogenase. amicyanin is transcribed as a precursor protein with a signal sequence, typical for periplasmic proteins. specific inactivation of amicyanin by means of gene replacement techniques resulted in the complete loss of the ability to grow on methylami ...19902261991
ph-dependent semiquinone formation by methylamine dehydrogenase from paracoccus denitrificans. evidence for intermolecular electron transfer between quinone cofactors.the quinonoid confactors of paracoccus denitrificans methylamine dehydrogenase exhibited a ph-dependent redistribution of electrons from the 50% reduced plus 50% oxidized to the 100% semiquinone redox form. this phenomenon was only observed at ph values greater than 7.5. the semiquinone was not readily reduced by addition of methylamine, consistent with the view that this substrate donates two electrons at a time to each cofactor during catalysis. once formed at ph 9.0, no change in redox state ...19902271681
ph-dependent redox activity and fluxionality of the copper site in amicyanin from thiobacillus yersutus as studied by 300- and 600- mhz 1h nmr.the kinetics of the deuteronation of one of the copper ligand histidines of the reduced type i blue-copper protein amicyanin from thiobacillus versutus was studied as a function of temperature by 300- and 600- mhz 1h nmr. the nmr data were analyzed with the help of a three site exchange model. deuteron exchange between the histidine ligand and the solution appears to be catalyzed by phosphate. after deuteronation the histidine can occur in two conformations. the electron self-exchange rate of am ...19902303425
biochemical and chemical characterization of pink-pigmented oxidative bacteria.the biochemical and chemical characteristics were determined for 156 clinical isolates of pink-pigmented bacteria that are similar to but distinct from methylobacterium extorquens (synonymous with pseudomonas mesophilica). these isolates were gram-negative, nonfermentative, usually nonvacuolated, coccoid rods; all grew at 35 degrees c and were catalase and urease positive; the majority grew on macconkey agar and were variable for oxidase production and motility. on the basis of oxidation of xylo ...19902332467
chemical cross-linking study of complex formation between methylamine dehydrogenase and amicyanin from paracoccus denitrificans.two soluble periplasmic redox proteins from paracoccus denitrificans, the quinoprotein methylamine dehydrogenase and the copper protein amicyanin, form a weakly associated complex that is critical to their physiological function in electron transport [gray, k. a., davidson, v. l., & knaff, d. b. (1988) j. biol. chem. 263, 13987-13990]. the specific interactions between methylamine dehydrogenase and amicyanin have been studied by using the water-soluble cross-linking agent 1-ethyl-3-[3-(dimethyla ...19902383547
the blue oxidases, ascorbate oxidase, laccase and ceruloplasmin. modelling and structural relationships.on the basis of the spatial structure of ascorbate oxidase [messerschmidt, a., rossi, a., ladenstein, r., huber, r., bolognesi, m., gatti, g., marchesini, a., petruzzelli, r. & finazzi-agro, a. (1989) j. mol. biol. 206, 513-529], an alignment of the amino acid sequence of the related blue oxidases, laccase and ceruloplasmin is proposed. this strongly suggests a three-domain structure for laccase closely related to ascorbate oxidase and a six-domain structure of ceruloplasmin. these domains demon ...19902404764
nucleotide sequence and transcriptional start site of the methylobacterium organophilum xx methanol dehydrogenase structural gene.the nucleotide sequence of a cloned 2.5-kilobase-pair smai fragment containing the methanol dehydrogenase (mdh) structural gene from methylobacterium organophilum xx was determined. a single open reading frame with a coding capacity of 626 amino acids (molecular weight, 66,000) was identified on one strand, and n-terminal sequencing of purified mdh revealed that 27 of these residues constituted a putative signal peptide. primer extension mapping of in vivo transcripts indicated that the start of ...19882459109
the poly-beta-hydroxybutyrate granule in vivo. a new insight based on nmr spectroscopy of whole cells.high resolution 13c nmr spectroscopy of live cells has been used to show that poly-beta-hydroxybutyrate (phb) is predominantly in a mobile state within the storage granules of alcaligenes eutrophus, methylobacterium extorquens, and methylobacterium am1. comparison of chemical and nmr analysis of phb indicates that about 70% of the polymer in a. eutrophus gives sharp observable resonances. temperature-dependent line widths and relaxation rates together with nuclear overhauser effect measurements ...19892492534
the second subunit of methanol dehydrogenase of methylobacterium extorquens am1.the nucleotide and deduced amino acid sequence of a novel small (beta) subunit of methanol dehydrogenase of methylobacterium extorquens am1 (previously pseudomonas am1) has been determined. work with the whole protein has shown that is has an alpha 2 beta 2 configuration.19892504152
plasmid analysis in pink facultative methylotrophic bacteria using a modified acetone-alkaline hydrolysis method.routine screening of indigenous and recombinant plasmids in pink facultative methylotrophic bacteria has been difficult, time-consuming, and yields variable results. we report a modified alkaline hydrolysis method for rapid plasmid isolation from these organisms that reproducibly results in good yields of closed circular plasmid dna which can be readily digested with restriction enzymes. this method greatly facilitates direct screening of indigenous and introduced recombinant plasmids in the met ...19892507392
studies on electron transfer from methanol dehydrogenase to cytochrome cl, both purified from hyphomicrobium x.ferricytochrome cl isolated from hyphomicrobium x is an electron acceptor in assays for homologous methanol dehydrogenase (mdh), albeit a poor one compared with artificial dyes. the intermediates of mdh seen during the reaction are identical with those observed with wurster's blue as electron acceptor, indicating that the reaction cycles are similar. the assay showed a ph optimum of approx. 7.0 and scarcely any stimulation by nh4cl, this being in contrast with assays with artificial dyes, where ...19892537627
mutants of methylobacterium organophilum unable to synthesize pqq.the phenotype of mutants unable to synthesize pqq is analyzed for different categories of methylotrophic bacteria. the advantages offered by strains dissimilating methylamine through methylated amino-acids are discussed. in m.organophilum, 40% of the mutants unable to grow in methanol medium but with normal methylamine utilization, were affected in pqq metabolism. the genetic properties of m. organophilum useful to study pqq mutants are discussed, mainly the use of psup106 to create insertion mu ...19892549861
pqq: biosynthetic studies in methylobacterium am1 and hyphomicrobium x using specific 13c labeling and nmr.using 13c labeling and nmr spectroscopy we have determined biosynthetic precursors of pyrroloquinoline quinone (pqq) in two closely related serine-type methylotrophs, methylobacterium am1 and hyphomicrobium x. analysis of the 13c-labeling data revealed that pqq is constructed from two amino acids: the portion containing n-6,c-7, 8, 9 and the two carboxylic acid groups, c-7' and 9', is derived-intact -from glutamate. the remaining portion is derived from tyrosine; the phenol side chain provides t ...19892549867
the 'methylamine oxidase' system of an obligate methylotroph.the terminal respiratory oxidase was solubilized from membranes of organism 4025, an obligate methylotroph. the partially purified oxidase is probably a cytochrome co. it does not oxidize amicyanin, but it oxidizes 'azurin' and cytochromes ch and cl. by using a complete 'methylamine oxidase' system reconstituted from pure methylamine dehydrogenase, purified oxidase and soluble blue copper proteins and cytochromes, it was confirmed that amicyanin is essential for methylamine oxidation; it could n ...19892549960
cloning and sequencing of the gene encoding the 72-kilodalton dehydrogenase subunit of alcohol dehydrogenase from acetobacter aceti.a genomic library of acetobacter aceti dna was constructed by using a broad-host-range cosmid vector. complementation of a spontaneous alcohol dehydrogenase-deficient mutant resulted in the isolation of a plasmid designated paa701. subcloning and deletion analysis of paa701 limited the region that complemented the deficiency in alcohol dehydrogenase activity of the mutant. the nucleotide sequence of this region was determined and showed that this region contained the full structural gene for the ...19892722742
a pink-pigmented, oxidative, nonmotile bacterium as a cause of opportunistic infections.we describe two cases of bacteremia due to a pink-pigmented, oxidative, nonmotile, gram-negative, rod-shaped organism. one case occurred in a febrile neutropenic patient and another in a chronically debilitated patient with pancreatic abscess. the first patient was cured with gentamicin and ticarcillin, but the second patient died while receiving cefamandole therapy. the organisms described here are similar to methylobacterium mesophilicum (pseudomonas mesophilica) and the "unnamed taxon" organi ...19892730267
the blue copper protein gene of alcaligenes faecalis s-6 directs secretion of blue copper protein from escherichia coli cells.the gene encoding a blue copper protein (a member of the pseudoazurins) of 123 amino acid residues, containing a single type i cu2+ ion, was cloned from alcaligenes faecalis s-6. the nucleotide sequence of the coding region, as well as the 5'- and 3'-flanking regions, was determined. the deduced amino acid sequence after glu-24 coincided with the reported sequence of the blue protein, and its nh2-terminal sequence of 23 residues resembled a typical signal peptide. the cloned gene was expressed u ...19872824441
genetic and physical analyses of methylobacterium organophilum xx genes encoding methanol oxidation.when allyl alcohol was used as a suicide substrate, spontaneous mutants and uv light- and nitrous acid-generated mutants of methylobacterium organophilum xx were selected which grew on methylamine but not on methanol. there was no detectable methanol dehydrogenase (mdh) activity in crude extracts of these mutants, yet western blots revealed that some mutants still produced mdh protein. complementation of 50 mutants by a cosmid gene bank of m. organophilum xx demonstrated that three major regions ...19882826390
resonance raman spectroscopy of amicyanin, a blue copper protein from paracoccus denitrificans.the copper binding site of amicyanin from paracoccus denitrificans has been examined by resonance raman spectroscopy. the pattern of vibrational modes is clearly similar to those of the blue copper proteins azurin and plastocyanin. intense resonance-enhanced peaks are observed at 377, 392, and 430 cm-1 as well as weaker overtones and combination bands in the high frequency region. most of the peaks below 500 cm-1 shift 0.5-1.5 cm-1 to lower energy when the protein is exposed to d2o. based on the ...19882830281
reassessment of copper stoichiometry in ascorbate oxidase.a very pure ascorbate oxidase solution was obtained by dissolving a crystalline sample of the enzyme. the ratio between 280 and 610 nm absorbancies was 22.5. it contained 8.0 +/- 0.2 cu ions, 50% epr detectable, per dimeric molecule (140,000 m.w.) with a molar extinction coefficient of 10,000 cm-1 at 610 nm. two cu ions were removed by treatment with n,n-diethyldithiocarbamate. the optical blue absorption band was unaffected, while two epr detectable cu ions were lost, with disappearance of the ...19882835039
the nucleotide sequence and deduced amino acid sequence of the genes for cytochrome cl and a hypothetical second subunit of the methanol dehydrogenase of methylobacterium am1. 19882842733
the nucleotide sequence and deduced amino acid sequence of the cytochrome cl gene of methylobacterium extorquens am1, a novel class of c-type cytochrome.the nucleotide sequence and deduced amino acid sequence of the cytochrome cl of methylobacterium extorquens (pseudomonas am1; methylobacterium am1) shows that this cytochrome c is completely different, except for its haem-binding site, from all other cytochromes.19882851998
localization of a pyrroloquinoline quinone biosynthesis gene near the methanol dehydrogenase structural gene in methylobacterium organophilum dsm 760.a partial sau3ai genomic bank of methylobacterium organophilum dsm 760 was constructed in the cosmid psup106 and moxf, the structural gene for methanol dehydrogenase, was isolated. in m. organophilum, psup106 behaves as a suicide plasmid. this property was used to insert tn5 into the bacterial chromosome, in the vicinity of moxf, by marker exchange. mobilization of the tn5-labelled chromosomal region by a broad-host-range plasmid, pjb3j1 (an r68-45 derivative), allowed the selection of several l ...19882855527
a search for intermediates in the bacterial biosynthesis of pqq.studies on the biosynthesis of pyrroloquinoline quinone (pqq) were performed with acinetobacter calcoaceticus pqq- -mutants belonging to genetically different complementation groups. all mutants were unable to grow on l-arabinose, the conversion of this substrate by the organism only occurring via membrane-bound quinoprotein (pqq-containing) glucose dehydrogenase. in general, the same observation and conclusion applied to shikimate and quinate, requiring active quinoprotein quinate dehydrogenase ...19882855587
a 2.0-a structure of the blue copper protein (cupredoxin) from alcaligenes faecalis s-6.the structure of a blue copper protein, cupredoxin, from the potent denitrifying bacterium alcaligenes faecalis s-6, has been determined and refined against 2 a x-ray diffraction data. the agreement between observed and calculated structure factors is 0.159, and estimated errors in coordinates are 0.09-0.15 a. the protein folds in a beta sandwich similar to plastocyanin and azurin and includes features such as a "kink" and a "tyrosine loop" which have been noted previously for these proteins as ...19892909547
primary structure of cucumber (cucumis sativus) ascorbate oxidase deduced from cdna sequence: homology with blue copper proteins and tissue-specific expression.cdna clones for ascorbate oxidase were isolated from a cdna library made from cucumber (cucumis sativus) fruit mrna. the library was screened with synthetic oligonucleotides that encode the nh2-terminal sequence of this enzyme. nucleotide sequence analysis of the cloned cdna inserts revealed a 1761-base-pair open reading frame that encoded an nh2-terminal signal peptide of 33 amino acids and a mature enzyme of 554 amino acids (mr, 62,258). the amino acid sequence deduced from nucleotide sequence ...19892919172
[transfer of prophage mu into methylotrophic bacteria in the plasmid rp4].bacteriophage mu genome has been transferred into the cells of pseudomonas methanolica and methylobacterium sp. skf240, that are naturally resistant to the bacteriophage, as a fragment of a hybrid plasmid rp4::mu cts62. temperature induction of the bacteriophage results in host cell lysis. plasmid rp::mu cis62 is maintained in methylotrophic cells presenting a cointegrative structure. the genetic and electrophoretic, analyses of the dna isolated from transconjugant cells have confirmed the concl ...19852948119
construction of broad-host-range cosmid cloning vectors: identification of genes necessary for growth of methylobacterium organophilum on methanol.four new cloning vectors have been constructed from the broad-host-range cloning vector prk290. these vectors, pla2901, pla2905, pla2910, and pla2917, confer resistance to kanamycin and tetracycline. the latter two are cosmid derivatives of pla2901. the new vectors can be mobilized into, and are stably maintained in, a variety of gram-negative bacteria. a sau3a genomic bank of methylobacterium organophilum strain xx dna has been constructed in pla2917, and complementation analysis, with a variet ...19852982796
[effect of aspartate amino acids on aspartokinase activity of oligotrophic bacteria].the object of this work was to study the effect of aspartate amino acids taken separately or in combinations on the aspartokinase activity of hyphomicrobium and methylobacterium methylotrophous strains. aspartokinase was shown to be a polyvalent enzyme regulated by the coordinated action of two amino acid pairs: lysine+threonine and threonine+methionine.19852989663
an inducible periplasmic blue copper protein from paracoccus denitrificans. purification, properties, and physiological role.when grown on methylamine as a sole carbon source, paracoccus denitrificans synthesizes a type i blue copper protein which mediates electron transfer between methylamine dehydrogenase and cytochrome c. this blue copper protein does not serve as an electron acceptor for methanol dehydrogenase and is not synthesized by cells grown on methanol or succinate. the blue copper protein and methylamine dehydrogenase were localized in the periplasm of p. denitrificans, whereas formate dehydrogenase was cy ...19852997215
isolation and characterization of a blue copper protein from thiobacillus versutus.the blue copper protein induced during growth of thiobacillus versutus on methylamine was purified and characterized. it is an acidic protein (isoelectric point 4.7), contains one cu2+ ion/enzyme molecule, is a monomeric protein (molecular mass about 14 kda), has a maximum in its absorption spectrum at 596 nm (molar absorption coefficient 3.9 x 10(3) m-1 cm-1), shows an axial type-i electron paramagnetic resonance spectrum (g parallel = 2.239, g perpendicular = 2.046 and a parallel = 5.6 mt) and ...19852998794
isolation and complementation analysis of 10 methanol oxidation mutant classes and identification of the methanol dehydrogenase structural gene of methylobacterium sp. strain am1.a method has been developed for the direct selection of methanol oxidation mutants of the facultative methylotroph methylobacterium sp. strain am1 (formerly pseudomonas sp. strain am1). using this direct selection technique, we have isolated mutants of methylobacterium sp. strain am1 that are no longer capable of growth on methanol but retain the ability to grow on methylamine. these methanol oxidation (mox) mutants were complemented with a genomic clone bank of this organism constructed in the ...19863009411
phenotypic characterization of 10 methanol oxidation mutant classes in methylobacterium sp. strain am1.twenty-five methanol oxidation mutants of the facultative methylotroph methylobacterium sp. strain am1 have been characterized by complementation analysis and assigned to 10 complementation groups, mox a1, a2, a3, and b through h (d. n. nunn and m. e. lidstrom, j. bacteriol. 166:582-591, 1986). in this study we have characterized each of the mutants belonging to the 10 mox complementation groups for the following criteria: phenazine methosulfate-dichlorophenolindophenol dye-linked methanol dehyd ...19863009412
characterization of two inducible periplasmic c-type cytochromes from paracoccus denitrificans.when grown on methanol or methylamine, paracoccus denitrificans synthesized three periplasmic soluble c-type cytochromes, cytochrome c550 and two additional cytochromes which were not present during growth on succinate and have not previously been characterized. these cytochromes have been separated from each other and their physical properties have been determined. the inducible cytochromes, c551i and c553i, exhibit mr and pi values of 22,000 and 3.5, and 30,000 and 3.8, respectively. cytochrom ...19863013855
measurement of the oxidation-reduction potentials of amicyanin and c-type cytochromes from paracoccus denitrificans.the oxidation-reduction potentials of four periplasmic electron carrier proteins from paracoccus denitrificans have been determined. their midpoint potentials are: amicyanin, 294 +/- 6 mv; cytochrome c-550, 253 +/- 5 mv; cytochrome c-551i, 190 +/- 4 mv; and cytochrome c-553i, 148 +/- 5 mv. although rapid amicyanin-mediated transfer of electrons from methylamine dehydrogenase to cytochrome c-551i was observed, reduced amicyanin did not reduce oxidized cytochrome c-551i in the absence of methylami ...19863021532
[transposon-mediated integration of the rp1 plasmid into chromosomes of methylotrophic bacteria].the homology region between the dna of plasmid rp1ts::tn601 and chromosome of the thermotolerant methylotrophic bacterium methylobacterium sp. skf240 has been constructed by transposon tn601 translocation into the chromosome. the clones of methylobacterium sp. skf240 having integrated the plasmid rp1 into the chromosome have been obtained by conjugation on the basis of above mentioned genetic technique. the integration of plasmid rp1 into the chromosomal dna of the methylotroph has been confirme ...19863029580
the methylamine oxidizing system of pseudomonas am1 reconstituted with purified components.the electron transport system coupled to the oxidation of methylamine in pseudomonas am1 was investigated by reconstituting it from the highly purified components. a mixture of methylamine dehydrogenase, cytochrome ch and cytochrome c oxidase (= cytochrome aa3) actively oxidized methylamine (161 mol of o2 consumed/mol of heme a of cytochrome c oxidase x min). in this system, addition of amicyanin did not affect the oxygen consumption rate. the oxygen consumption rate of the cell-free extract pre ...19873034870
evolution of blue copper proteins.the evolutionary relationships of blue copper proteins are reviewed. five homologous families of small blue proteins are recognized. despite differences in length their peptide chains can all be accommodated into the eight-stranded fold of plastocyanin with some adjustments at three of the loops and the two termini. the c-termini of the blue oxidases ceruloplasmin and neurospora laccase also fit into this fold and they are suggested to be homologous to the small blue proteins. the alignment of t ...19883043463
purification and properties of the hydroxylase component of methane monooxygenase.methane monooxygenase from methylobacterium sp. strain crl-26 which catalyzes the oxygenation of hydrocarbons was resolved into two components, a hydroxylase and a flavoprotein. an anaerobic procedure was developed for the purification of the hydroxylase to homogeneity. the molecular weight of the hydroxylase as determined by gel filtration was 220,000, and that determined by sedimentation equilibrium analysis was about 225,000. the purified hydroxylase contained three nonidentical subunits with ...19873106336
isolation and nucleotide sequence of the methanol dehydrogenase structural gene from paracoccus denitrificans.a genomic clone bank of paracoccus denitrificans dna has been constructed in the expression vector set pex1, pex2, and pex3. screening of this clone bank with antibodies raised against p. denitrificans methanol dehydrogenase resulted in the isolation of a clone, pnh3, that synthesized methanol dehydrogenase cross-reactive proteins. the nucleotide sequence of the p. denitrificans dna fragment inserted in this clone has been determined and shown to contain the full methanol dehydrogenase structura ...19873114231
identification of putative methanol dehydrogenase (moxf) structural genes in methylotrophs and cloning of moxf genes from methylococcus capsulatus bath and methylomonas albus bg8.an open-reading-frame fragment of a methylobacterium sp. strain am1 gene (moxf) encoding a portion of the methanol dehydrogenase structural protein has been used as a hybridization probe to detect similar sequences in a variety of methylotrophic bacteria. this hybridization was used to isolate clones containing putative moxf genes from two obligate methanotrophic bacteria, methylococcus capsulatus bath and methylomonas albus bg8. the identity of these genes was confirmed in two ways. a t7 expres ...19883129400
the moxfg region encodes four polypeptides in the methanol-oxidizing bacterium methylobacterium sp. strain am1.the polypeptides encoded by a putative methanol oxidation (mox) operon of methylobacterium sp. strain am1 were expressed in escherichia coli, using a coupled in vivo t7 rna polymerase/promoter gene expression system. two mox genes had been previously mapped to this region: moxf, the gene encoding the methanol dehydrogenase (medh) polypeptide; and moxg, a gene believed to encode a soluble type c cytochrome, cytochrome cl. in this study, four polypeptides of mr 60,000, 30,000, 20,000, and 12,000 w ...19883129405
prokaryotic hopanoids: the biosynthesis of the bacteriohopane skeleton. formation of isoprenic units from two distinct acetate pools and a novel type of carbon/carbon linkage between a triterpene and d-ribose.incorporation of 13c-labelled acetate into the hopanoids of the purple non-sulfur bacteria rhodopseudomonas palustris and rhodopseudomonas acidophila and the facultative methylotroph methylobacterium organophilum showed that the bacteriohopane skeleton is built from an unique carbon/carbon linkage between the triterpenic hopane moiety and the c-5 carbon of a d-ribose derivative arising from the non-oxidative pentose phosphate pathway. furthermore a probable compartmentation of the acetate metabo ...19883136017
plasmid analysis and cloning of the dichloromethane-utilization genes of methylobacterium sp. dm4.the dichloromethane (dcm)-utilizing facultative methylotroph methylobacterium sp. dm4 was shown to contain three plasmids with approximate size of 120 kb, 40 kb and 8 kb. curing experiments suggested that the dcm-utilization character was correlated with the possession of an intact 120 kb plasmid. the dcm-utilization genes were cloned on the broad-host-range vector pvk100. plasmid pme1510, a recombinant plasmid carrying a 21 kb hindiii fragment complemented dcm-utilization-negative derivatives o ...19883141582
complex formation between methylamine dehydrogenase and amicyanin from paracoccus denitrificans.two proteins isolated from paracoccus denitrificans, the copper-containing electron carrier amicyanin and the pyrroloquinoline quinone-containing enzyme methylamine dehydrogenase, have been shown to form a complex. complex formation between methylamine dehydrogenase and either oxidized or reduced amicyanin resulted in alterations in the absorbance spectrum of the pyrroloquinoline quinone prosthetic group of methylamine dehydrogenase. binding of amicyanin to the enzyme exhibited positive cooperat ...19883170535
preliminary x-ray crystallographic studies of methylamine dehydrogenase and methylamine dehydrogenase--amicyanin complexes from paracoccus denitrificans. 19883210240
Displaying items 1 - 100 of 783