Publications

TitleAbstractYear(sorted ascending)
Filter
PMID
Filter
distribution and morphological characteristics of efferent neurons innervating end organs in the ear and lateral line of the european eel.neurons that provide the efferent innervation to the labyrinthine and lateral line sense organs of the eel were located by applying horseradish peroxidase to branches of the appropriate cranial nerves. retrogradely labeled neurons were found in a single median column, the octavolateralis efferent nucleus (oen), located immediately rostral to and overlapping with the facial nucleus of the branchiomotor column. we estimate that on each side of the brain the efferent nucleus contains about 60-70 ne ...19872448346
acute toxicity of organochlorined pesticides to the european eel, anguilla anguilla: the dependency on exposure time and temperature. 19872444293
capacity of the european eel (anguilla anguilla) to elongate and desaturate dietary linoleic acid.the ability of eels (anguilla anguilla) to further desaturate and chain elongate linoleic acid, 18:2n-6, was studied by feeding diets containing either corn oil or a fish oil to groups of elvers for 12 wk and analyzing proportions of fatty acids in tissue lipids. over the 12-wk period elvers given both dietary treatments increased in weight by fourfold. the proportion of arachidonic acid, 20:4n-6, present in polar lipids of elvers fed the diet containing corn oil increased from an initial value ...19873114442
[demonstration of specific binding sites for carp gonadotropin in ovary membrane preparations of anguilla (anguilla anguilla l.)].membrane preparations from silver eel ovary bind specifically labeled carp gonadotropin (cgth 125i); similar preparations from kidney, liver, brain, and muscle exhibit either no or negligible specific binding. cgth and partially purified eel pituitary extract, but neither hcg nor btsh, inhibit cgth 125i specific binding in a dose-dependent way. however, a high membrane concentration can bind hcg 125i and this binding is partly inhibited by excess hcg, thus suggesting the existence of a relativel ...19873817443
testis cytological structure, plasma sex steroids, and gonad cytosol free steroid receptors of heterologous gonadotropin (hcg)-stimulated silver eel, anguilla anguilla l.complete testicular maturation was induced in silver eels, kept at 24 degrees in fresh water, by a single injection of 1000 i.u. of heterologous gonadotropin (hcg). each week, for 4 weeks, some eels were examined for testis structural pattern, plasma sex steroids, and gonad cytosol steroid receptors. the first effect of the hcg was on the tubular organization of the testis, followed by spermatogenesis. plasma androgens were not detectable in the untreated eels, whereas a peak was detected a week ...19873817439
melanin concentrating hormone inhibits the release of alpha msh from teleost pituitary glands.a radioimmunoassay was developed for salmonid melanin concentrating hormone (mch) and used to measure immunoreactive (ir)mch in the hypothalamus and pituitary of trout (salmo gairdneri) and eels, (anguilla anguilla) maintained under different regimes of background color. in trout, 95% of the total irmch was located in the pituitary gland. the amount of mch in both pituitary and hypothalamus was increased when white-adapted trout were transferred to a black background. in eels, a similar change o ...19873803904
comparative studies on lipid metabolism in various salt transporting organs of the european eel (anguilla anguilla). mono-unsaturated phosphatidylethanolamine as a key substance.1. incorporation in vivo into tissue lipids of (1-14c)acetate added to the water in the incubation tank showed the same relative distribution pattern of 14c-activity among various phospholipids in the gills, the esophagus and the intestine, when the eel was incubated in sea-water; in fresh water this pattern was found only in the intestine, while both the gills and the esophagus showed a relative excess of 14c-label in phosphatidylethanolamine (pe). 2. similar studies with (32p)phosphate also sh ...19873677610
[in vitro translation of rna extracted from corpuscules of stannius of the eel (anguilla anguilla); identification of the precursor of parathyrin in the corpuscules of stannius (pcs)].corpuscles of stannius (cs) of teleosts secrete a pth like hormone (parathyrin of cs: pcs) which is involved in calcium metabolism by acting mainly at the gill level. translated products encoded by mrna extracted from eel corpuscles of stannius and among these, translated products immunoprecipitated by anti b-pth immunserum were compared to the products synthetized during incubation of the glands with labelled methionine. the analysis was performed by polyacrylamide gel electrophoresis and fluor ...19873105830
plasma concentrations of ovarian steroids in the freshwater european silver eel (anguilla anguilla l.): effects of hypophysectomy and transfer to sea water.intact and hypophysectomized freshwater (fw) silver eels were transferred to tanks of fw or artificial sea water (sw; salinity = 0.60 osmol/l) which were simultaneously renewed twice a week. fish were killed 2 months after transfer and plasma was assayed for ovarian steroids. in all fish, 5 alpha-androstane-3 beta,17 beta-diol was present, while 5 alpha-dihydrotestosterone and 5 alpha-androstane-3 alpha,17 beta-diol were undetectable. in intact fw eels, plasma levels of testosterone, 5 alpha-and ...19873655616
solubility of nitrogen and argon in eel whole blood and its relationship to ph.the solubility coefficients (alpha) for the inert gases, nitrogen (n2) and argon (ar), were measured by mass spectrometry in whole blood of the freshwater-adapted european eel, anguilla anguilla, at varied ph and at two temperatures, 5 and 15 degrees c. the ph was altered either by varying pco2 (0.75-75 mmhg; 1 mmhg = 133.3 pa) or by adding fixed acid (hcl or lactic acid). no dependence of alpha on ph (range 5.5-8.4) or on lactate concentration (range 0.2-25 mmol l-1) was detectable. average val ...19883373142
structural studies of nerve terminals containing melanin-concentrating hormone in the eel, anguilla anguilla.eels were adapted to black- or white-coloured backgrounds and the pituitary glands were prepared for light and electron microscopy. immunocytochemical staining was used to study the distribution of the neurohypophysial melanin-concentrating hormone in the neurointermediate lobe. the hormone was located in small, elliptical, electron-opaque neurosecretory granules, measuring approximately 120 x 90 nm. the neurones terminated on blood vessels in the centre of the neurohypophysis and on the basemen ...19883345554
diel and seasonal rhythms of the heart rate in the common eel (anguilla anguilla l.): role of cardiac innervation.using a computerized system, ecg recordings of eels were made during long-term experiments, to show circadian and circannual variations in the heart rate. the circadian variations synchronize with the photoperiod. the maximum frequency is observed during the dark phase, the peak values occurring just after sunset and before sunrise. by using specific blockers--atropine, propranolol, desmethylimipramine--the respective roles of neurotransmitters (acetylcholine and catecholamines) were evaluated. ...19883384071
identification of hypocalcin (teleocalcin) isolated from trout stannius corpuscles.we have isolated and purified a glycoprotein from the corpuscles of stannius (cs) of trout, which we consider hypocalcin (also called teleocalcin), the major hypocalcemic hormone of fish. this product is present in relatively large amounts in the cs of several species (i.e., european eel, tilapia, goldfish, and carp). hypocalcin is typically released from the cs in response to an experimentally induced increase of the blood calcium concentration. ultrastructural observations show that after this ...19883360288
efficacy of fumagillin against myxidium giardi cépéde, 1906 infection of the european eel (anguilla anguilla): new observations on myxidiosis of imported glass eels. 19883254089
a study of barosensitivity in the european eel (anguilla anguilla, l.): effects of arterial pressure changes on heart rate and ventilation.a study of the effects of arterial pressure changes on heart rate and ventilation was carried out on the eel (anguilla anguilla l.). the anatomical characteristics of this fish enabled extracorporeal circulation in both the ventral and dorsal aorta to be set up. the pressure was changed mechanically, either by clamping external circulations or, in some cases, by modifying the frequency of a pulsatory pump placed in series with the heart, thus ensuring constant blood flows in the ventral aorta. t ...19883220126
retinal fine structure in the european eel anguilla anguilla. viii. photoreceptors of the sexually mature silver eel stage.the morphology of the photoreceptors of the sexually mature silver eel has been investigated by electron microscopy and these findings compared with observations made on the photoreceptors of the glass, yellow and sexually immature silver eel stages of the lengthy life cycle of the european eel (anguilla anguilla). as in previous stages the photoreceptors of the sexually mature silver eel are adequately described as either rods or single cones. the rod: cone ratio at this stage is about 200: 1 w ...19883189854
retinal fine structure in the european eel anguilla anguilla. vii. pigment epithelium of the sexually mature silver eel stage.this report describes the morphology of the retinal pigment epithelium (rpe), bruch's membrane and choriocapillaris in the sexually mature silver eel and compares these observations with previous descriptions of this region in the glass, yellow and sexually immature silver eel stages of the lengthy life cycle of the european eel. the retinal epithelium in the sexually mature silver eel is a single layer of cuboidal to squamous cells joined laterally by apically located cell junctions. both the b ...19883189844
retinal fine structure in the european eel anguilla anguilla. vi. photoreceptors of the sexually immature silver eel stage.this report deals with the fine structure of the photoreceptors of the sexually immature silver eel and compares these findings with previous observations on the glass and yellow eel stages of the life cycle of the european eel. the photoreceptors of the sexually immature glass eel are readily categorized as either rods or cones. no multiple cones are observed. the rod:cone ratio is about 100:1, which is greater than that of either the glass or yellow eel stages. rods and perhaps cones also are ...19883189834
retinal fine structure in the european eel anguilla anguilla. v. pigment epithelium of the sexually immature silver eel stage.the fine structure of the retinal pigment epithelium (rpe), bruch's membrane and choriocapillaris has been investigated in the sexually immature silver eel and compared with previous observations made at the glass and yellow eel stages of the lengthy life cycle of the european eel. as in the previous stages the retinal pigment epithelium of the sexually immature silver eel consists of a single layer of cuboidal to squamous cells joined laterally by apically located cell junctions. the basal (scl ...19883189826
basolateral amino acid and glucose transport by the intestine of the teleost, anguilla anguilla.1. d-glucose transport into blmv was osmotically reactive, sodium independent, and inhibited by phloretin but not by phloridzin. 2. the survey of 6 l-amino acids identified three groups with respect to transfer across the basolateral cell border. transport of proline and glutamate occurred by na-dependent carriers and by apparent simple diffusion. alanine, lysine and phenylalanine were transported by na-independent carriers and apparent simple diffusion. glycine transport was stimulated above ap ...19882907446
the mechanical properties of polyneuronally innervated, myotomal muscle fibres isolated from a teleost fish (myoxocephalus scorpius).single or small bundles of fibres were isolated from the abdominal myotomes of the sculpin myoxocephalus scorpius, a teleost with a polyneuronal pattern of fast muscle innervation. fibres responded to a supra-threshold stimulus with an all-or-none twitch. tetanic fusion frequency at 3 degrees c was 40-60 hz, and the twitch tetanus ratio 0.70. maximum isometric tension was 281 kn m-2. similar isometric contractile properties were obtained from the focally innervated fast muscle fibres of another ...19883194174
arginine vasotocin binding to isolated branchial cells of the eel: effect of salinity.binding of 125i-labelled arginine vasotocin (avt) was studied in isolated intact gill cells obtained from eels (anguilla anguilla) adapted to fresh water (fw) or to sea water (sw). experiments carried out at 20 degrees c showed maximum and stable binding beyond 10 min of incubation. specific binding, determined by using labelled peptide in the presence or absence of an excess of unlabelled hormone, represented 30-50% of total and was reversible, with a half-time of less than 5 min. scatchard plo ...19883255360
lethal toxicity of lindane on a teleost fish, anguilla anguilla from albufera lake (spain): hardness and temperature effects.this paper reports the results of toxicity tests conducted using anguilla anguilla under three different water temperature (15, 22 and 29 degrees c) and two hardness regimes (250 and greater than 600 ppm caco3). the 96-h lc50 increased in the experimental medium (p less than 0.05) by an order of magnitude from 0.32 to 0.45 mg/l between 15 and 29 degrees c. however in the natural medium it is similar (p greater than 0.05) (0.54 to 0.55 mg/l) for these same temperatures. the toxicity of lindane on ...19882453551
somatostatin-related and glucagon-related peptides with unusual structural features from the european eel (anguilla anguilla).peptides derived from prosomatostatins i and ii and from two distinct proglucagons have been isolated from the pancreas of a teleost fish, the european eel (anguilla anguilla). the product of prosomatostatin i processing, somatostatin-14, is identical to mammalian somatostatin-14. a 25-amino-acid-residue peptide (ser-val-asp-asn-gln5-gln-gly-arg-glu-arg10-lys-ala-gly-cys- lys15-asn-phe-tyr- trp-lys20-gly-pro-thr-ser-cys25) is derived from prosomatostatin ii. compared with the corresponding pepti ...19882904391
a peptide from the eel pancreas with structural similarity to human pancreatic secretory trypsin inhibitor.the primary structure of a 61-amino-acid residue peptide from the pancreas of the european eel (anguilla anguilla) has been established as e e k s g(5)l y r k p(10)s c g e m(15)s a m h a(20)c p m n f(25)a p v c g(30)t d g n t(35)y p n e c(40)s l c f q(45)r q n t k(50)t d i l i(55)t k d d r(60)c. there was no indication of microheterogeneity. this peptide shows structural similarity to pancreatic secretory trypsin inhibitors from several mammalian species and to a cholecystokinin-releasing peptid ...19883371360
effects of vertebrate prolactins and growth hormones on thyroxine 5'-monodeiodination in the eel (anguilla anguilla): a potential bioassay for growth hormone.growth hormones (ghs) and prolactins (prls) purified from representatives of each vertebrate class from bony fish onwards were tested for their ability to stimulate in vivo peripheral deiodination of labeled thyroxine (t4*) into triiodo-l-thyronine (t3*) in the eel. plasma t3*/t4* ratio was used as parameter. all ghs significantly increased t3*/t4*, the magnitude of the response being unrelated to the phylogenic position of species. no significant stimulation was shown with the various prl, with ...19892707580
triiodothyronine binding to putative solubilized nuclear thyroid hormone receptor in liver and gill of the brown trout (salmo trutta) and the european eel (anguilla anguilla).the binding of 3,5,3'-triiodothyronine (t3) to salt-extracted nuclear protein of liver and gill from trout and eel was studied in vitro. [125i]t3 binding depended on the temperature and protein concentration. binding equilibria were achieved in the two tissues of each species between 15 and 24 hr at 4 degrees. the binding was reversible in the presence of excess unlabeled t3. scatchard analysis showed a single class of high affinity and low capacity t3 binding species considered, 2.71 x 10(-10) ...19892806877
saccharide residues in human gingiva as revealed with fluorochrome-coupled lectins.the histochemical binding of 16 fluorochrome-conjugated lectins to human marginal gingiva was investigated. of a total of 14 galactose/n-acetylgalactosamine (gal/galnac)-specific lectins, dolichos biflorus (dba), helix pomatia (hpa), and helix aspersa agglutinins (haa) were blood group a-reactive whereas griffonia simplicifolia i-b4 (gsa-i-b4) and sophora japonica (sja) agglutinins were blood group b-reactive. hpa, haa and gsa-i-b4 bound to all suprabasal epithelial cells and to vascular endothe ...19892542513
distribution and pharmacological properties of the gabaa/benzodiazepine/chloride ionophore receptor complex in the brain of the fish anguilla anguilla.in the present study, we characterized the distribution and the pharmacological properties of the different components of the gabaa receptor complex in the brain of the eel (anguilla anguilla). benzodiazepine recognition sites labeled "in vitro" with [3h]flunitrazepam ([3h]fnt) were present in highest concentration in the optic lobe and in lowest concentration in the medulla oblongata and spinal cord. a similar distribution was observed in the density of gamma-[3h]aminobutyric acid ([3h]gaba) bi ...19892538558
demonstration of bone resorbing cells in elasmobranchs: comparison with osteoclasts.we have previously shown that elasmobranchs-characterized by a partially calcified cartilaginous endoskeleton-presented a bony vertebral arch containing osteoblasts, osteocytes and resorbing cells. the aim of this study is to test the ability of elasmobranchs to resorb bone tissue. the subcutaneous implantation in dogfish (scyliorhinus canicula) of devitalized mineral-containing bone particles, obtained from a bony fish (the eel, anguilla anguilla) resulted, after 21 2 months, in the formation o ...198918620290
basolateral inositol transport by intestines of carnivorous and herbivorous teleosts.myoinositol transport by isolated basolateral membrane vesicles was characterized from intestines of the herbivorous tilapia (oreochromis mossambicus) and the carnivorous eel (anguilla anguilla). [3h]myoinositol transport occurred by nonelectrogenic, facilitated diffusion independent of cation gradients and was inhibited by phloretin (ki = 0.6 and 0.9 mm for tilapia and eel, respectively) but not by phloridzin. kinetic analysis of myoinositol influx disclosed no differences in concentration yiel ...19892923212
brush-border inositol transport by intestines of carnivorous and herbivorous teleosts.transport characteristics of myoinositol by isolated brush-border membrane vesicles of two fish, the herbivorous tilapia (oreochromis mossambicus) and the carnivorous eel (anguilla anguilla), were measured. [3h]myoinositol uptake by vesicles of both fish was stimulated by a transmembrane na gradient, was electrogenic, and was inhibited by phloridzin. kinetic analysis of myoinositol influx disclosed species differences (tilapia, k = 0.15 mm, jmax = 0.2 nmol.mg protein-1.min-1; eel, k = 2.6 mm, jm ...19892923211
cupula displacement, hair bundle deflection, and physiological responses in the transparent semicircular canal of young eel.the transparent labyrinth of young eels (anguilla anguilla l.) was used in toto for studying the configuration of cupula displacement, deflection of the hair bundle, and correlated changes in transepithelial voltage (delta tev) and nerve activity (delta na) in the semicircular canal. microcapillaries were introduced into the canal through holes produced by a microthermocauter. mechanical stimulation was applied either by injection of fluid into the ampulla or by electromagnetically displacing fe ...19892740206
influence of protein content of diet on growth and lipid composition of european eel muscle and liver.the influence of diet protein content (35-45-55%) on growth and lipid composition of muscle and liver of european eel (anguilla anguilla) was studied for the first time. in control eel, triacylglycerols constituted about 90% of total lipids in muscle and about 40% in liver. triacylglycerol content in eel muscle significantly increased after two months of treatment with any diet assayed, with independence of protein content and source. in liver, this increase was comparatively higher in herring m ...19892475082
ionic and total calcium levels in the blood of the european eel (anguilla anguilla): effects of stanniectomy and hypocalcin replacement therapy.removal of the corpuscles of stannius (stx) in the freshwater european eel causes a marked increase in the concentrations of blood ionic calcium and protein-bound calcium. the hypercalcaemia peaks 20 days after stx and lasts at least another 20 days. in stanniectomized eels hypocalcin decreased both blood ionic and total calcium concentrations. the reduction of plasma total calcium concentration by hypocalcin is attributed to a reduction in blood ionic calcium concentration. we conclude that hyp ...19892926317
water and lactate movement in the swimbladder of the eel, anguilla anguilla.hemoglobin (hb) and lactate (la) concentrations were measured in small (150 microliters) blood samples collected with micropipettes from the inflow and outflow vessels of the rete mirabile of the eel swimbladder. hemoglobin was used as a marker of the intravascular space. 1. hemoglobin concentrations suggest that there was no significant water movement between the arterial and venous capillaries in the rete, but a significant 6% water efflux from the vascular space into the swimbladder epitheliu ...19892813987
effects of long-term exposure to hydrostatic pressure per se (101 ata) on eel metabolism.oxygen consumption, mo2, has been measured in yellow freshwater eels (anguilla anguilla l.) exposed in normoxic conditions for 31 days at a hydrostatic pressure of 101 ata (atmosphere absolute; 1 ata = 0.1 mpa) using a high pressure water circulation system. the results (series i) show that from a maximal value observed at the end of compression, mo2 decreases exponentially with time (tau congruent to 1.4 days) then reaches a steady state (mo2 = 0.67 +/- 0.05 mmol.h-1.kg-1) at a lower level than ...19892611722
partial purification of parathyrin from the corpuscles of stannius (pcs) of the eel (anguilla anguilla, l.).it has been previously shown that the eel corpuscles of stannius (cs) synthesize and secrete a substance (pcs) which is functionally and immunologically related to the mammalian parathyrin family. purification of pcs, including anion-exchange chromatography, ods c-18 reverse-phase hplc, and affinity chromatography, showed that a biologically active peak, eluted in 32% acetonitrile, contains a 32- to 34-kda protein which is 600-fold more potent than the crude extract is a test involving the hypoc ...19892599351
solute back-diffusion raises the gas concentrating efficiency in counter-current flow.we have extended the counter-current model of the rete mirabile of the fish swimbladder to include the effects of inert gas secretion into the swimbladder as well as solute back-diffusion in the rete capillaries. (1) gas secretion attenuates the inert gas concentrating efficiency of the rete, i.e. its ability to produce high inert gas partial pressures in blood at the swimbladder pole. the maximum attainable gas secretion rate depends on the salting-out effect, i.e. on the ratio of solubility in ...19892554452
how many na+-dependent carriers for l-alanine and l-proline in the eel intestine? studies with brush-border membrane vesicles.using brush-border membrane (bbm) vesicles prepared from the intestine of the european eel, the specificity of l-alanine and l-proline na+-dependent transport was investigated by measuring the uptake of isotopically labelled substrates. in the presence of na+ ions, cross-inhibition between alanine and proline transports was observed; in addition alpha-(methylamino)isobutyric acid (meaib) inhibited proline but had no effect on alanine uptake. these results can be explained by the presence, in eel ...19892765548
the gnrh systems in the brain and pituitary of normal and hcg treated european silver eels.the distribution of immunoreactive gnrh was studied in the brain and pituitary gland of normal and human chorionic gonadotrophin (hcg) injected silver eels. it was found that the general organization of gnrh systems in this species is similar to that reported in other teleosts. cell bodies were present in the olfactory bulbs, ventral telencephalon, periventricular hypothalamus and dorsal tegmentum. no positive perikarya could be detected in the preoptic region. only scarce fibers were observed i ...198924221596
na-dependent l-glutamate transport by eel intestinal bbmv: role of k+ and cl-.l-[3h]glutamate uptake into eel (anguilla anguilla) intestinal brush-border membrane vesicles (bbmv) was a sigmoidal function of extravesicular na, suggesting that two or more cations accompanied the amino acid during transport. l-[3h]glutamate influx illustrated the following kinetic constants: apparent membrane binding affinity (kapp) = 0.80 +/- 0.12 mm; influx velocity (jmax) = 2.61 +/- 0.31 nmol.mg protein-1.min-1; and permeability coefficient (p) = 0.65 +/- 0.10 microliters.mg protein-1. mi ...19892568760
positive feedback control by the gonads on gonadotropin (gth) and gonadoliberin (gnrh) levels in experimentally matured female silver eels,anguilla anguilla.treatment of sham-operated female silver eels with carp pituitary extract stimulated ovarian development and induced increases in pituitary gonadotropin (gth) and gonadoliberin (gnrh) contents. both effects of carp pituitary extract were abolished in ovariectomized eels, indicating the involvement of the gonads. endogenous sexual steroids, the secretion of which was increased during sexual maturation, should be responsible for the stimulation of gth and gnrh levels. ovariectomy itself had no sig ...198924221767
ventilatory and circulatory adjustments in the european eel (anguilla anguilla l.) exposed to short term hypoxia.respiratory and circulatory (measured and calculated) variables were obtained at the same time in resting eels, during normoxia and after 1 h exposure to environmental hypoxia (water po2 of 40 torr). in normoxia, values of respiratory and circulatory variables appeared less than those reported for most other fish. these differences could be partly explained by a lower level of standard metabolism and a greater uptake of o2 through the skin. hypoxia caused a marked decrease in heart rate (40%), c ...19892920810
immunocytochemical analysis of the dopamine system in the brain and spinal cord of the european eel, anguilla anguilla.the distribution of dopamine-containing perikarya and fibres in the central nervous system of the eel, anguilla anguilla, was determined by using a specific dopamine antiserum. telencephalic dopamine-immunoreactive somata are located in the external cell layer of the olfactory bulb and throughout the rostrocaudal extent of the subpallium; immunoreactive fibres are located primarily in the bulb and in ventral and lateral portions of the hemispheres. diencephalic dopamine-immunoreactive neurons ar ...19892802190
isolation and primary structure of the c-peptide of proinsulin from the european eel (anguilla anguilla).1. the primary structure of the c-peptide of proinsulin from the european eel has been established as: dvepllgflspksgqenevddfpykgqgel. the peptide was isolated from the extract of eel pancreas in a yield that was approximately equimolar with insulin. a comparison with the predicted structures of c-peptides from other teleost fishes has identified a domain in the central region of the peptide that has been more highly conserved than the rest of the molecule.19892776429
microhabitats of monogenean gill parasites on european eel (anguilla anguilla).the distribution of adult pseudodactylogyrus anquillae and p. bini and postlarvae was recorded on glass-eels and pigmented eels of different size and infection intensity. the two species occupied different microhabitats on the host's gill apparatus but the preferred sites depended partly on host size. postlarval migration was indicated. mortality of young parasites, reinforcement of reproductive barriers and competition seems to be less likely explanations of the spatial distribution.19892488048
myosin structure in the eel (anguilla anguilla l.). demonstration of three heavy chains in adult lateral muscle.myosin extracts from central white fibers and peripheral red fibers of the lateral muscle of eel (anguilla anguilla) were analysed by electrophoresis under non-dissociating conditions, which demonstrated a polymorphism of myosin isoforms. the light and heavy subunit content of the isomyosins was established using sds-page and two-dimensional electrophoresis. in the central white muscle, 3 myosin isoforms fm3, fm2, fm1, were characterized by 3 types of fast light chain and one fast heavy chain hc ...19902269355
lysine transport by brush-border membrane vesicles of eel intestine: interaction with neutral amino acids.l-[3h]lysine uptake was measured in brush-border membrane vesicles prepared from intestinal mucosa of the european eel anguilla anguilla. lysine uptake occurred via 1) a nonsaturable component with an apparent diffusional permeability (p) of 0.58 microliter.mg protein-1.min-1,2) a na-dependent transport system [half-saturation constant (kapp) 0.16 mm, maximal transport rate (jmax) 3.57 nmol.mg protein-1.min-1]; 3) a na-independent transport system (kapp 0.17 mm, jmax 2.77 nmol.mg protein-1.min-1 ...19902124427
the na(+)-dependent proline carrier, of eel intestinal brush-border membrane, sequentially binds proline and then na+.the mechanism of na+/l-proline cotransport, present on brush-border membrane (bbm) vesicles of the european eel intestine, was studied. initial cotransport rates, depending on increasing proline and na+ concentrations in the extravesicular medium (zero-trans conditions), were measured by monitoring the decay of an inside-negative membrane potential, i.e. the fluorescence quenching of the voltage-sensitive cyanine dye 3,3'-diethylthiacarbocyanine iodide (dis-c2(5)). by simultaneously estimating t ...19902397223
influence of inorganic lead on the biochemical blood composition of the eel, anguilla anguilla l.yellow eels (anguilla anguilla l.) with an average weight of 50 g were caught in september in the aveiro lagoon on the portuguese west coast and kept in aerated aquaria for 1 week before the experiment started. the eels were exposed to an inorganic lead concentration of 300 micrograms pb/liter for 30 days. differential white blood cell count showed an increase in the number of lymphocytes in exposed fish. blood hemoglobin and number of red blood cells per cubic millimeter showed no differences b ...19902226244
metabolic effects of kraft mill effluents on the eel anguilla anguilla l.yellow eels (anguilla anguilla l.) with an average weight of 60 g were used in this experiment. the fish were caught in june/july at the aveiro lagoon on the portuguese west coast, transported to the department of biology, aveiro university, and kept in aerated aquaria for 1 week before the experiment started. the eels were then exposed for 1 and 3 weeks to 75 and 50% of the kraft pulp mill effluent. the eels exposed to the kraft pulp mill effluent developed an increase in red blood cell number ...19902226239
molecular cloning and sequence analysis of the cdna for the putative beta subunit of the type-ii gonadotrophin from the european eel.oestradiol treatment enhances type-ii gonadotrophin (gth-ii) synthesis in the european eel (anguilla anguilla) at the silver stage. as a first step in studying the molecular mechanisms involved in this stimulation, we cloned and characterized the cdna encoding the beta subunit of eel gth-ii. a cdna library was constituted in lambda gt10 from oestradiol-treated eels. it was screened using an oligodeoxyribonucleotide mixed probe designed to be complementary to a highly conserved region of cdnas fr ...19902116136
[regional and recent trends in the chlorinated hydrocarbon levels in eels from berlin waters].during the five year period from early 1982 to 1986, we engaged in research concerning the chlorinated hydrocarbon content of eels (anguilla anguilla l.) in the limnic water ecosystem of berlin (west). the total count of analytical samples, taken at 11 different sampling points, comprised 370 samples, divided up into 41 collectives. each fish was checked individually for the patterns of contamination with chlorinated hydrocarbons, especially ddt-, bhc-, and pcb-related compounds. the various are ...19902353916
co2 back-diffusion in the rete aids o2 secretion in the swimbladder of the eel.in order to estimate the relative importance of back-diffusion of o2 and co2 for their partial pressure enhancement in the swimbladder, we have determined o2 and co2 partial pressure and content and ph in microsamples collected non-obstructively from the afferent and efferent rete vessels in the european eel. 1. the po2 increased significantly along the arterial vessels of the rete (from 33 to 303 torr), with no change in o2 content, suggesting o2 not to be exchanged in the rete counter-current ...19902113304
influence of fatty acid composition of diet on cholesterol content of eel liver and muscle.the influence of different diets on cholesterol content of liver and muscle of european eel (anguilla anguilla) was studied for the first time. in control eel, cholesterol constituted near 7.5% of total lipids in liver and about 1% in muscle. feeding herring meal-55% diet produced a drastic increase in hepatic cholesterol after a 30 d period. in muscle, cholesterol content also increased after any dietary treatment. free cholesterol represented about 34% of total cholesterol in liver and about 5 ...19901692683
[hormonal stimulation, in vivo, of the ovary of european eel in the yellow stage].the immature ovary of yellow eel was stimulated by a long-term treatment with a gonadotropin ii rich extract of carp pituitary. ovarian follicles of treated yellow eels showed an accumulation of lipidic vacuoles in the oocyte cytoplasm and a thickened follicular envelope (in this regard, they resembled the ovarian follicles of previously studied silver eels). the treatment also resulted in a significant but limited increase in the gonadosomatic ratio and mean follicle size (these values were muc ...19902291806
an experimental study of the retinal projections of the european eel (anguilla anguilla), carried out at the catadromic migratory silver stage.a radioautographic study of the european eel (anguilla anguilla) was carried out in ten female specimens at the catadromic migratory silver stage. terminal arborizations of contralaterally projecting visual fibres were identified in ten hypothalamic structures (area optica preoptica ventralis and the nuclei suprachiasmaticus, opticus hypothalamicus ventromedialis, preopticus magnocellularis lateralis, posterioris lateralis, posterioris dorsalis periventricularis posterioris dorsalis lateralis, p ...19902254656
effects of hyperbaric pressure and temperature on atria from ectotherm animals (rana pipiens and anguilla anguilla).1. spontaneously beating atria from frogs (r. pipiens) and eels (a. anguilla) were compressed hydraulically to 10 mpa. effects on beating frequency and twitch tension were studied. 2. at low temperatures (8-10 degrees c) compression to 10 mpa caused a slowing of the beat frequency. no effects were noted at higher temperatures (16-24 degrees c). twitch tension was decreased by pressure at low temperatures and increased at high temperatures. 3. differences were noted between preparations from cold ...19901968818
chromatographic and immunological evidence for mammalian gnrh and chicken gnrh ii in eel (anguilla anguilla) brain and pituitary.gonadotropin-releasing hormone (gnrh) peptides in the brain and pituitary of the european eel (anguilla anguilla) were investigated by reverse phase high performance liquid chromatography (hplc) and radioimmunoassay with region-specific antisera. two gnrh molecular forms were demonstrated in brain and pituitary extracts. one form eluted in the same position as synthetic mammalian gnrh on hplc and was recognized by antibodies directed against the nh2 and cooh termini of mammalian gnrh as well as ...19902199948
difference in the ability of blood group-specific lectins and monoclonal antibodies to recognize the abh antigens in human tissues.twelve different kinds of blood group-specific lectins have been used along with monoclonal anti-a, -b and -h antibodies for detecting the corresponding antigens in selected human tissues. although most of the lectins recognized the antigens in the tissue sections examined, they displayed marked differences in their recognition patterns in certain tissues. helix asparsa agglutinin (haa), helix pomatia agglutinin (hpa) and monoclonal anti-a antibody recognized a antigens in the mucous cells of sa ...19901705925
cloning and sequence analysis of the cdna for the pituitary glycoprotein hormone alpha-subunit of the european eel.a cdna library constructed using mrnas isolated from pituitary glands of estradiol-treated eels was screened with a cdna fragment for the rat glycoprotein hormone alpha-subunit. three out of 10,000 cdna clones were revealed and subcloned in puc13 for characterization and sequencing. all three had the same nucleotide sequence except for a single, silent change in the coding sequence for one of them, and for the location of the poly(a) tail. analysis of the deduced amino acid sequence strongly sug ...19901698669
characterization of pore-forming activity in liver mitochondria from anguilla anguilla. two porins in mitochondria?a fast purification procedure for the isolation and purification of eukaryotic porin (de pinto et al., (1987) biochim. biophys. acta 905, 499-502) was applied to liver mitochondria of the fish anguilla anguilla. a protein preparation was obtained which formed slightly anionically selective pores in reconstitution experiments with lipid bilayer membranes. the distribution of single-channel conductances had two maxima of 2.4 ns and 4.0 ns in 1 m kcl. sodium dodecylsulfate electrophoretograms of th ...19911705440
lectins from triticum vulgaris and limax flavus are universal antagonists of botulinum neurotoxin and tetanus toxin.lectins from anguilla anguilla, artocarpus integrifolia, canavalia ensiformis, datora stramonium, glycine max, limax flavus, ricinus communis and triticum vulgaris were tested for their abilities to antagonize the binding of botulinum neurotoxin and tetanus toxin to rat brain membranes and to antagonize the ability of these toxins to block neuromuscular transmission in mouse phrenic nerve-hemidiaphragm preparations. lectins from limax flavus and triticum vulgaris, both of which have affinity for ...19911653841
potential interactions between acanthocephalus anguillae and pomphorhynchus laevis in their natural hosts chub, leuciscus cephalus and the european eel, anguilla anguilla.chub and eels were experimentally infected via intermediate hosts harbouring cystacanths, with pomphorhynchus laevis alone, or acanthocephalus anguillae alone, or simultaneously with mixtures of both species in varying proportions, and sampled at 7, 56 or 112 days post-infection. examination of chub revealed that both species showed low establishment and growth rates, differing markedly from british field data, where chub is apparently one of the most important hosts, and preventing further mean ...19911852495
occurrence of acanthocephalus clavula (acanthocephala) in echinogammarus pungens (amphipoda) from the river adige.cystacanths of acanthocephalus clavula dujardin 1845 (acanthocephala) were found in the hemocoels of naturally infected echinogrammarus pungens m. edwards 1840 (amphipoda). crustaceans were collected in porto frossone, an estuarine locality of the river adige. only 3 out of 562 e. pungens specimens were infected by a. clavula cystacanths; the larvae were enclosed in a thin acellular envelope. infected amphipods were all females, and their total length was greater than that of uninfected females. ...19911844501
in vivo and in vitro toxicity of fractionated fish lipids, with particular regard to their content of chlorinated organic compounds.six different lipid matrices (the intact lipid (il), four lipid fractions with different polarity, and the free fatty acids (ffas) obtained by hydrolysis of the triacylglycerol (tag) containing fraction) were obtained from salmon (salmo salar) and eel (anguilla anguilla), each collected at a contaminated and a comparatively uncontaminated catch site along the coast of scandinavia. the lipid matrices were studied in toxicological test systems representing various biological functions of different ...19911766922
effects of lindane on fish carbohydrate metabolism.exposure of the european eel (anguilla anguilla) to a high sublethal concentration of 0.335 ppm (0.50 of the 96-hr lc50) of lindane for 6, 12, 24, 48, 72, and 96 hr affected carbohydrate metabolism. muscle glycogen levels decreased significantly (p less than 0.05) at 6, 12, 24, 48, 72, and 96 hr; liver glycogen content did not decline at any time. muscle glucose levels in fish were elevated at 6, 12, 24, 48, 72, and 96 hr but in liver, the levels increased only at 96 hr. mean values of muscle an ...19911717227
[purification and characterization of presumed thyrotropic hormone subunits of a teleost fish, the eel (anguilla anguilla)].we have only a partial knowledge of fish thyrotropins (tsh) and no data about peptide sequence are available. various hplc techniques allowed us to purify a 31.4 kda, heterodimeric protein from saline eel pituitary extracts containing tsh activity. partial n-terminal sequence (24 amino acids) from one subunit was strictly identical to that of eel gonadotropin ii (gth ii) alpha subunit. with regard to the second subunit, 41% of the 22 amino acids identified at the n-terminus were homologous to th ...19911933511
regeneration of lateral line and inner ear vestibular cells.labelling experiments with [3h]thymidine demonstrate a continuous production of cells in the mechanoreceptive lateral line organs of the eel (anguilla anguilla) and butterfly fish (pantodon buchholzi) as well as in the electroreceptive ampullary organ of the transparent catfish (kryptopterus bicirrhus). shortly after [3h]thymidine injection many cells are labelled in the middle and basal parts of the sensory organ and after a few days' survival sensory cells are also labelled. the vestibular sen ...19911752161
age-related decrease in the density of benzodiazepine recognition sites in the brain of the fresh water eel (anguilla anguilla).the binding parameters of benzodiazepine receptors labeled with [3h]flunitrazepam were investigated in the brain of male adult eels at the trophic phase (4 years old) and of male silver eels (6 year old ocean migrants). the density of [3h]flunitrazepam binding sites was significantly decreased (-26%) in the brain of silver eels compared with younger counterparts. in contrast, the apparent dissociation constant (kd) was not significantly different in the two experimental groups. these results are ...19911667812
prostaglandins in the kidney, urinary bladder and gills of the rainbow trout and european eel adapted to fresh water and seawater.prostaglandins in kidney, gills, and urinary bladder of freshwater-adapted and seawater-adapted rainbow trout, oncorhynchus mykiss (= salmo gairdneri), and european eel, anguilla anguilla, were determined by solid-phase extraction of tissue homogenates and high-pressure liquid chromatography. prostaglandins e2, e1, f1 alpha, f2 alpha, and d2 and the more stable metabolite of prostacyclin, 6-keto f1 alpha, occurred in these osmoregulatory tissues. in gill filaments and kidneys of both eel and tro ...19911783277
effects of 17 beta-estradiol and carp gonadotropin on vitellogenesis in normal and hypophysectomized european silver female eel (anguilla anguilla l.) employing a homologous radioimmunoassay for vitellogenin.the european silver eels are at the early stages of vitellogenesis before the marine reproductive migration. vitellogenesis was induced by 17 beta-estradiol (e2) alone and by a purified carp gonadotropin (cgth). we studied and compared their effects on plasma vitellogenin (vg) levels and ovarian yolk contents in female normal (n) and hypophysectomized (h) eels for both treatments. to this purpose an homologous radioimmunoassay (ria) was established. eel vg was purified to homogeneity on 0.1% sds ...19911783271
regulation of secretion of the teleost fish hormone stanniocalcin: effects of extracellular calcium.the release in vivo and in vitro of stanniocalcin (stc) from the corpuscles of stannius (cs) of the rainbow trout and the european eel was studied. intraperitoneal injection of cacl2 (2.45 mmol.kg-1 fish) leads to an elevation of both ionic and total calcium in the plasma and results in the release of stc from the cs into the blood. release of stc in vitro is not affected at "physiological" (1.0-1.5 mm) or lower ca2+ levels in the incubation medium. high levels of ca2+ (2.5 mm and higher), howev ...19911778405
histochemical, connectional and cytoarchitectonic evidence for a secondary reduction of the pretectum in the european eel, anguilla anguilla: a case of parallel evolution.there are at least three different patterns of pretectal organization in teleost fishes: a simple pattern observed in cyprinids, an elaborate pattern present in percomorphs, and an intermediately complex pattern seen in many other teleost groups. the taxonomic distribution of the pretectal patterns indicates that the simple and the elaborate patterns are both evolutionarily derived (apomorphic) from the primitive (plesiomorphic) intermediately complex one. in anguillids, the pretectal pattern ob ...19911764633
induction of biotransformation in the liver of eel (anguilla anguilla l.) by sublethal exposure to dinitro-o-cresol: an ultrastructural and biochemical study.structural and functional alterations in hepatocytes of the european eel, anguilla anguilla, following a 4-week-exposure to 5, 50, and 250 micrograms/liter dinitro-o-cresol (dnoc) were investigated by means of electron microscopy and biochemistry and compared to liver pathology in eels exposed to the chemical spill into the rhine river at basle in november 1986. whereas phenological parameters (growth, condition factor) are unaffected, ultrastructural and biochemical alterations are detectable a ...19912065626
comparative acute toxicities of selected pesticides to anguilla anguilla.the acute toxicities (24, 48, 72 and 96 hr) of eight pesticides to anguilla anguilla were determined. the organochlorine pesticide, endosulfan was the most toxic, with lc50 values in the range of 0.042 to 0.041 mg/l. endosulfan was followed in order of decreasing toxicity by diazinon, fenitrothion, chlorpyrifos, lindane, methidathion, trichlorfon and methylparathion. when fishes were exposed to the pesticides tested they exhibited signs of restlessness, erratic swimming, convulsions and difficul ...19911723417
the effect of time on physiological changes in eel anguilla anguilla, induced by lindane.1. eel were exposed to a sublethal concentration of lindane (0.335 ppm) for 6, 12, 24, 48, 72 and 96 hr. 2. concentrations of glycogen, glucose, lactate, pyruvate and lipids were determined in gill tissue after lindane exposure. 3. gill glycogen decreased and glucose levels increased at 6 hr of treatment, lactate and pyruvate concentration increased between 6 and 48 hr. total lipid values decreased between 6 and 24 hr; thereafter, the levels increased up to 72 hr of exposure. 4. clear changes we ...19911713818
significant year-to-year variation of the response to radiation-induced stress shown by gill fatty acid metabolism in eels (anguilla anguilla) captured from the wild.1. in eels captured in roskilde fjord in 1972 and 1975, a specifically enhanced synthesis was found from 14c-acetate of 14c-labelled mono-unsaturated fatty acids (c16:1 and c18:1) relative to saturated fatty acids (c16:0 and c18:0) in sea water 4 days after irradiation (10 gy, 60co). 2. corresponding experiments in 1976 and 1982 showed rather the opposite: irradiation resulted in more 14c-labelled saturated fatty acids relative to unsaturated fatty acids, both in fresh and sea water. 3. the latt ...19911677881
changes in selected biochemical parameters in the brain of the fish, anguilla anguilla (l.), exposed to lindane. 19911722731
the primary structure of glucagon-like peptide but not insulin has been conserved between the american eel, anguilla rostrata and the european eel, anguilla anguilla.insulin was isolated from the pancreas of the american eel, anguilla rostrata, and its primary structure was established as (formula: see text). eel insulin contains unusual substitutions at b-21, b-22, and b-26 in the putative receptor-binding region of the molecule compared with other mammalian and fish insulins. the a-chain of insulin from the european eel contains an asparagine rather than a serine residue at position a-12. similarly, amino acid composition data indicate the b-chain of insul ...19911874385
regulation of the type-ii gonadotrophin alpha and beta subunit mrnas by oestradiol and testosterone in the european eel.the gonadotrophic function of the european eel (anguilla anguilla l.) at the silver stage is very weak: gonadotrophin-releasing hormone (gnrh) secretion is deficient and, moreover, dopamine inhibition overrides gnrh action. at the silver stage, oestradiol stimulates the biosynthesis of the type-ii gonadotrophin (gth-ii). to study the molecular mechanism of this activation further, we examined the effect of testosterone and oestradiol administration on pituitary levels of mrna encoding gth-ii alp ...19911892544
comparative study of acetylcholine synthesis in organs of freshwater teleosts.the activity of acetylcholine (ach) synthesizing enzyme, choline acetyltransferase (chat), and the content of ach were determined in the brain, heart, red trunk muscle and midgut of 12 freshwater teleost species belonging to eight families: carp (cyprinus carpio), tench (tinca tinca), silver carp (hypophthalmichtys molitrix), bighead (hypophthalmichtys nobilis), wels (silurus glanis), cat fish (ictalurus nebulosus), eel (anguilla anguilla), rainbow trout (oncorhynchus mykiss), pike (esox lucius) ...199124214667
effects of vasoactive intestinal polypeptide, substance p, 5-hydroxytryptamine, met-enkephalin and neurotensin on the swimbladder smooth muscle of two teleost species,gadus morhua andanguilla anguilla.the effects of vasoactive intestinal polypeptide (vip), substance p (sp), 5-hydroxytryptamine (5-ht), neurotensin (nt) and met-enkephalin (menk) on the smooth muscles of the teleost swimbladder were studied in two teleost species, the atlantic cod (gadus morhua) and the eel (anguilla anguilla). the study was made on isolated strip preparations of the muscularis mucosae, using putative transmitters corresponding to the immunoreactive materials that have previously been localized by immunohistoche ...199124214612
in vitro study on the impact of fish sera on the survival and fine structure of the eel-pathogenic acanthocephalan paratenuisentis ambiguus.the effects of fish sera on the growth and fine structure of infective larvae of the eel-pathogenic acanthocephalan paratenuisentis ambiguus (eoacanthocephala: tenuisentidae) were studied under in vitro conditions using sera from the final host anguilla anguilla and from two accidental fish hosts as well as fetal calf serum. as controls larvae were also kept in medium in the absence of serum and in experimentally infected eels. sera from the accidental fish hosts carp and rainbow trout exerted t ...19911805215
h+/glycyl-glycine cotransport in eel intestinal brush-border membrane vesicles: studies with the ph-sensitive dye acridine orange.monitoring the fluorescence quenching of the ph-sensitive dye acridine orange, proton accumulation in the presence of an inside-negative transmembrane potential was measured in eel (anguilla anguilla) intestinal brush-border membrane vesicles. it was demonstrated that the proton accumulation was specifically increased by the presence of the dipeptide glycyl-glycine in the extravesicular space, showing saturation kinetics at increasing dipeptide concentrations and was specifically inhibited by di ...19921327139
the use of texture analysis for the discrimination of nissl substance in neurons.structural changes induced by cordotomy in the nissl substance of identifiable spinal motoneurons innervating the white musculature of the european eel were quantified with the use of texture features calculated from digitized images. data were evaluated and the motoneurons classified by using multivariate analysis. the study shows that there are differences in the structural organization of the nissl substance of motoneurons taken from control and cordotomized fishes. distinction could only be ...19921282188
chlorinated hydrocarbons in eels (anguilla anguilla l.) from the river rhine. 19921522922
effects of ambient ion concentrations on gill atpases in fresh water eel,anguilla anguilla.branchial activities of na(+),k(+)-atpase (ouabain sensitive), mg(2+) atpase (ouabain insensitive) and kinetic analysis of high and low affinity ca(2+) atpase were measured inanguilla anguilla that had been acclimated to demineralized water (dw, ca < 10 μm), freshwater (fw, ca = 2 mm), and low calcium freshwater (l-ca, ca = 0.9 mm). na(+),k(+)-atpase activity decreased while ouabain insensitive activity increased when ambient ca(2+) decreased. two kinetic forms of ca(2+) atpase could be resolved ...199224214197
acute toxicity, uptake and clearance of diazinon by the european eel, anguilla anguilla (l.).the toxicity, accumulation, and elimination of diazinon were investigated for the european eel, anguilla anguilla. the 24, 48, 72 and 96-h median lethal concentrations (lc50) were 0.16, 0.11, 0.09 and 0.08 mg/l, respectively. fish exposed to sublethal concentration (0.042 mg/l) accumulated diazinon in liver and muscle tissues. bioconcentration factors (bcf) of diazinon were 1850 in liver, and 775 in muscle over the 96-h exposure period. upon removal from diazinon containing water the contaminate ...19921593096
lindane-induced changes in carbohydrate metabolism in anguilla anguilla.1. anguilla anguilla (l.) was exposed to a sublethal concentration of 0.167 ppm (0.25 of the 96-hr lc50) of lindane for 6, 12, 24, 48, 72 and 96 hr. 2. changes in glycogen, glucose, pyruvate and lactate contents of liver and muscle after lindane exposure, were studied. 3. muscle and liver glycogen levels decreased significantly during the exposure time. muscle glucose values increased but on the other hand we found a decrease in those of liver. 4. muscle and liver pyruvate content increased as d ...19921379899
effect of insulin in the diet on the growth of european eels (anguilla anguilla l.).the effect of oral administration of insulin, in various concentrations, on the growth of european eels (anguilla anguilla l.) was studied. in order to determine whether the insulin penetrated through the stomach or gills to the blood system, 5 ml insulin, suspended in an 0.6% solution of nacl, was inserted via the mouth of eels, and the insulin content in the blood measured by radioimmunoassay immediately, and at one and two hours after administration. a control group was given 0.6% nacl alone. ...199224214275
atrial natriuretic peptide in the eel, anguilla anguilla l.: its cardiac distribution, receptors and actions on isolated branchial cells.the presence of atrial natriuretic peptide (anp) and the nature of its binding sites were studied in fresh-water (fw)- and seawater (sw)-adapted eels using a heterologous analogue, that of the rat (ranp). rat anp-like immunoreactivity was demonstrated in the cardiac atria and ventricles of both fw and sw eels, and electron-dense anp-like granules were observed. the atria and ventricles of fw eels contained significantly more granules than those of sw animals and, in both types, the atria were mo ...19921329803
a comparison of highly unsaturated fatty acid levels in wild and farmed eels (anguilla anguilla).1. absolute and relative amounts of eicosapentaneoic acid (epa) and docohexaenoic acid (dha) in muscle of eels from four different fish farms were compared with samples from wild eels from two different areas of northern italy. 2. farmed eels were richer in dha and epa than wild animals. 3. the addition of cod liver oil to the diet of farmed eels led to a significant accumulation of epa and dha, but no change in total lipid content. 4. the calculation of two indices related to highly unsaturated ...19921499279
affinity purification of antigen-specific serum immunoglobulin from the european eel (anguilla anguilla).immunization of specimens of the european eel with a hapten-carrier conjugate resulted in a significant rise in anti-hapten titres. antigen-specific immunoglobulin was purified on a matrix onto which the hapten-carrier conjugate had been immobilized. rabbit antisera raised against the product of the affinity purification recognized two molecular moieties. the first was eel immunoglobulin as inferred by the polypeptide composition, i.e. disulphide-linked heavy and light chains of 72 kda and 25 kd ...19921615286
[implication of growth hormone in experimental induction of vitellogenesis by estradiol-17 beta in female silver eel (anguilla anguilla l.)].the effect of different preparations of growth hormone (gh) was assayed with 17 beta-estradiol on vitellogenesis in hypophysectomized or normal female silver eels. vitellogenin (vg) plasma levels were taken as the index of hepatic vitellogenesis. the e2 doses were chosen to give the same pattern for the plasma vg level as in the controls. they decreased or remained undetectable in hypophysectomized or normal animals. gh also failed to induce alone a significant modification. when e2 was injected ...19921638433
effect of decreased oxygen content on eels (anguilla anguilla) infected by anguillicola crassus (nematoda: dracunculoidea).the survival chances of eels with anguillicola crassus infection of varying intensity and with varying pathological changes were studied in an experimental system devoid of fresh oxygen supply. eels most severely affected by anguillicolosis died first, while those with less expressed pathological lesions tolerated sublethal oxygen levels for a longer time. findings were similar at 20-21 degrees c and at 27-28 degrees c; at 27-28 degrees c, however, the fish required a higher oxygen content to su ...19938017238
determination of the ca2+ and mg2+ affinity constants of troponin c from eel skeletal muscle and positioning of the single tryptophan in the primary structure.the complete amino acid sequence of troponin c (etnc) from the white muscle of the european eel has been determined by edman degradation procedures. its single tryptophan residue is situated in helix h at amino acid position 152 of the aligned sequence; the tryptophan is the first residue on the c-terminal side of ca2+ binding loop iv. the increase of tryptophan fluorescence emission intensity occurring upon titration of etnc with ca2+ has been used to determine the affinity constants of etnc fo ...19938126218
differential distribution and response to experimental sexual maturation of two forms of brain gonadotropin-releasing hormone (gnrh) in the european eel, anguilla anguilla.using specific radioimmunoassays for the two gnrh molecular forms present in the european eel, anguilla anguilla, (mgnrh and cgnrh ii), we compared their distributions in the pituitary and different parts of the brain of female silver eels, as well as the modifications of their levels in experimentally matured female eels (treated with carp pituitary extract). in control eels, mgnrh levels were higher than cgnrh ii levels in the pituitary, olfactory lobes and telencephalon, di- and mesencephalon ...199324202465
ascorbic acid transport by intestinal brush-border membrane vesicles of the teleost anguilla anguilla.transport of l-ascorbate by intestinal brush-border membrane vesicles of european eel anguilla anguilla was stimulated by a transmembrane na gradient (out > in) but not by a similarly directed gradient of k. under short-circuited membrane potential conditions, a kinetic analysis of l-ascorbate influx indicated the presence of a single na-dependent carrier process (kapp = 0.75 +/- 0.07 mm and jmax = 0.33 +/- 0.03 nmol.mg protein-1.min-1) and a nonsaturable transfer component with an apparent diff ...19938322981
Displaying items 301 - 400 of 1365